KEGG   Homo sapiens (human): 51729Help
Entry
51729             CDS       T01001                                 

Gene name
WBP11, NPWBP, PPP1R165, SIPP1, WBP-11
Definition
WW domain binding protein 11
Orthology
K12866  
WW domain-binding protein 11
Organism
hsa  Homo sapiens (human)
Pathway
Spliceosome
Module
Spliceosome, Prp19/CDC5L complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Transcription
   03040 Spliceosome
    51729 (WBP11)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     51729 (WBP11)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19 complex
    51729 (WBP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
HGNC: 
HPRD: 
Vega: 
UniProt: 
Position
12p12.3
AA seq 641 aa AA seqDB search
MGRRSTSSTKSGKFMNPTDQARKEARKRELKKNKKQRMMVRAAVLKMKDPKQIIRDMEKL
DEMEFNPVQQPQLNEKVLKDKRKKLRETFERILRLYEKENPDIYKELRKLEVEYEQKRAQ
LSQYFDAVKNAQHVEVESIPLPDMPHAPSNILIQDIPLPGAQPPSILKKTSAYGPPTRAV
SILPLLGHGVPRLPPGRKPPGPPPGPPPPQVVQMYGRKVGFALDLPPRRRDEDMLYSPEL
AQRGHDDDVSSTSEDDGYPEDMDQDKHDDSTDDSDTDKSDGESDGDEFVHRDNGERDNNE
EKKSGLSVRFADMPGKSRKKKKNMKELTPLQAMMLRMAGQEIPEEGREVEEFSEDDDEDD
SDDSEAEKQSQKQHKEESHSDGTSTASSQQQAPPQSVPPSQIQAPPMPGPPPLGPPPAPP
LRPPGPPTGLPPGPPPGAPPFLRPPGMPGLRGPLPRLLPPGPPPGRPPGPPPGPPPGLPP
GPPPRGPPPRLPPPAPPGIPPPRPGMMRPPLVPPLGPAPPGLFPPAPLPNPGVLSAPPNL
IQRPKADDTSAATIEKKATATISAKPQITNPKAEITRFVPTALRVRRENKGATAAPQRKS
EDDSAVPLAKAAPKSGPSVPVSVQTKDDVYEAFMKEMEGLL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgggacggagatctacatcatccaccaagagtggaaaatttatgaaccccacagaccaa
gcccgaaaggaagcccggaagagagaattaaagaagaacaaaaaacagcgcatgatggtt
cgagctgcagttttaaagatgaaggatccaaaacagataatccgagacatggagaaattg
gatgaaatggagtttaacccagtgcaacagccacaattaaatgagaaagtactgaaagac
aagcgtaaaaagctgcgtgaaacctttgaacgtattctacgactctatgaaaaagagaat
ccagatatttacaaagaattgagaaagctagaagtagaatatgaacagaagagggctcaa
cttagccaatattttgatgctgtcaagaatgctcagcatgtggaagtggagagtattcct
ttgccagatatgccacatgctccttccaacattttgatccaggacattccacttcctggt
gcccagccaccctctatcctaaagaaaacctcagcctatggacctccaactcgggcagtt
tctatccttcctcttcttggacatggtgttccacgtttgccccctggcagaaaacctcct
ggccctccccctggtccacctcctcctcaagtcgtgcagatgtatggccgtaaagtgggt
tttgccctagatcttccccctcgtaggcgagatgaagacatgttatatagtcctgaactt
gcccagcgaggtcatgatgatgatgtttctagcaccagtgaagatgatggctatcctgag
gacatggatcaagataagcatgatgacagtactgatgacagtgacaccgacaaatcagat
ggagaaagtgacggggatgaatttgtgcaccgtgataatggtgagagagacaacaatgaa
gaaaagaagtcaggtctgagtgtacggtttgcagatatgcctggaaaatcaaggaagaaa
aagaagaacatgaaggaactgactcctcttcaagccatgatgcttcgtatggcaggtcaa
gaaatccctgaggagggacgggaagtagaggaattttcagaggacgatgatgaagatgat
tctgatgactctgaagcagaaaagcaatcacaaaagcagcataaagaggaatcccattct
gatggcacatccactgcttcttcacagcagcaggctccgccgcagtctgttcctccttct
cagatacaagcacctcccatgccaggaccaccacctcttggaccaccacctgctccacca
ttacggcctcctgggccacctacaggccttcctcctggtccacctccaggagctcctcca
ttcctgagaccacctggaatgccaggactccgagggcccttaccccgacttttacctcca
ggaccaccaccaggccgaccccctggccctcccccaggtccacctccaggtctgcctcct
ggtccccctcctcgtggacccccaccaaggctacctccccctgcacctccaggtattcct
ccacctcgtcctggcatgatgcgcccacctttggtgcctccccttggacctgccccccct
gggctgttcccaccagctcccttgccaaaccctggggttttaagtgccccacccaacttg
attcagcgacccaaggcggatgatacaagtgcagccaccattgagaagaaagccacagca
accatcagtgccaagccacagatcactaatcccaaggcagagattactcgatttgtgccc
actgcactgagagtacgtcgggagaataaaggggctactgctgctccccaaagaaagtca
gaggatgattctgctgtgcctcttgccaaagcagcacccaaatctggtccttctgttcct
gtctcagtacaaactaaggatgatgtctatgaggctttcatgaaagagatggaagggcta
ctgtga

DBGET integrated database retrieval system