KEGG   Homo sapiens (human): 51733Help
Entry
51733             CDS       T01001                                 

Gene name
UPB1, BUP1
Definition
ureidopropionase, beta (EC:3.5.1.6)
Orthology
K01431  
beta-ureidopropionase [EC:3.5.1.6]
Organism
hsa  Homo sapiens (human)
Pathway
Pyrimidine metabolism
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Drug metabolism - other enzymes
Metabolic pathways
Module
Pyrimidine degradation, uracil => beta-alanine, thymine => 3-aminoisobutanoate
Disease
H00200  
Beta-ureidopropionase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    51733 (UPB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    51733 (UPB1)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    51733 (UPB1)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    51733 (UPB1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.6  beta-ureidopropionase
     51733 (UPB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.2
AA seq 384 aa AA seqDB search
MAGAEWKSLEECLEKHLPLPDLQEVKRVLYGKELRKLDLPREAFEAASREDFELQGYAFE
AAEEQLRRPRIVHVGLVQNRIPLPANAPVAEQVSALHRRIKAIVEVAAMCGVNIICFQEA
WTMPFAFCTREKLPWTEFAESAEDGPTTRFCQKLAKNHDMVVVSPILERDSEHGDVLWNT
AVVISNSGAVLGKTRKNHIPRVGDFNESTYYMEGNLGHPVFQTQFGRIAVNICYGRHHPL
NWLMYSINGAEIIFNPSATIGALSESLWPIEARNAAIANHCFTCAINRVGTEHFPNEFTS
GDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDGLLVAKLDLNLCQQVNDVWNFKMTG
RYEMYARELAEAVKSNYSPTIVKE
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgctgagtggaagtcgctggaggaatgcttggagaagcacctgccgctcccc
gacttgcaggaagtgaagcgcgttctctatggcaaggaactcaggaagcttgatctgccc
agggaagctttcgaagctgcctccagagaagactttgaactgcagggatatgcctttgaa
gcagcggaggagcagctgagacgaccccgcattgtgcacgtggggctggttcagaacaga
atccccctccccgcaaatgcccctgtggcagaacaggtctctgcccttcatagacgcata
aaggctatcgtagaggtggctgcaatgtgtggagtcaacatcatctgtttccaggaagca
tggactatgccctttgccttctgtacgagagagaagcttccttggacagaatttgctgag
tcagcagaggatgggcccaccaccagattctgtcagaagctggcgaagaaccatgacatg
gtggtggtgtctcccatcctggaacgagacagcgagcatggggatgttttgtggaataca
gccgtggtgatctccaattccggagcagtcctgggaaagaccaggaaaaaccacatcccc
agagtgggtgatttcaacgagtcaacttactacatggagggaaacctgggccaccccgtg
ttccagacgcagttcggaaggatcgcggtgaacatttgctacgggcggcaccaccccctc
aactggcttatgtacagcatcaacggggctgagatcatcttcaacccctcggccacgata
ggagcactcagcgagtccctgtggcccatcgaggccagaaacgcagccattgccaatcac
tgcttcacctgcgccatcaatcgagtgggcaccgagcacttcccgaacgagtttacctcg
ggagatggaaagaaagctcaccaggactttggctacttttatggctcgagctatgtggca
gcccctgacagcagccggactcctgggctgtcccgtagccgggatggactgctagttgct
aagctcgacctaaacctctgccagcaggtgaatgatgtctggaacttcaagatgacgggc
aggtatgagatgtacgcacgggagctcgccgaagctgtcaagtccaactacagccccacc
atcgtgaaagagtag

DBGET integrated database retrieval system