KEGG   Homo sapiens (human): 51742Help
Entry
51742             CDS       T01001                                 

Gene name
ARID4B, BCAA, BRCAA1, RBBP1L1, RBP1L1, SAP180
Definition
(RefSeq) AT-rich interaction domain 4B
  KO
K19195  
AT-rich interactive domain-containing protein 4B
Organism
hsa  Homo sapiens (human)
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HDAC complexes
    Sin3A-HDAC complex
     51742 (ARID4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q42.3
AA seq 1312 aa AA seqDB search
MKALDEPPYLTVGTDVSAKYRGAFCEAKIKTAKRLVKVKVTFRHDSSTVEVQDDHIKGPL
KVGAIVEVKNLDGAYQEAVINKLTDASWYTVVFDDGDEKTLRRSSLCLKGERHFAESETL
DQLPLTNPEHFGTPVIGKKTNRGRRSNHIPEEESSSSSSDEDEDDRKQIDELLGKVVCVD
YISLDKKKALWFPALVVCPDCSDEIAVKKDNILVRSFKDGKFTSVPRKDVHEITSDTAPK
PDAVLKQAFEQALEFHKSRTIPANWKTELKEDSSSSEAEEEEEEEDDEKEKEDNSSEEEE
EIEPFPEERENFLQQLYKFMEDRGTPINKRPVLGYRNLNLFKLFRLVHKLGGFDNIESGA
VWKQVYQDLGIPVLNSAAGYNVKCAYKKYLYGFEEYCRSANIEFQMALPEKVVNKQCKEC
ENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIP
THSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEEKAKSGDETNKEEDEDDE
EAEEEEEEEEEEEDEDDDDNNEEEEFECYPPGMKVQVRYGRGKNQKMYEASIKDSDVEGG
EVLYLVHYCGWNVRYDEWIKADKIVRPADKNVPKIKHRKKIKNKLDKEKDKDEKYSPKNC
KLRRLSKPPFQTNPSPEMVSKLDLTDAKNSDTAHIKSIEITSILNGLQASESSAEDSEQE
DERGAQDMDNNGKEESKIDHLTNNRNDLISKEEQNSSSLLEENKVHADLVISKPVSKSPE
RLRKDIEVLSEDTDYEEDEVTKKRKDVKKDTTDKSSKPQIKRGKRRYCNTEECLKTGSPG
KKEEKAKNKESLCMENSSNSSSDEDEEETKAKMTPTKKYNGLEEKRKSLRTTGFYSGFSE
VAEKRIKLLNNSDERLQNSRAKDRKDVWSSIQGQWPKKTLKELFSDSDTEAAASPPHPAP
EEGVAEESLQTVAEEESCSPSVELEKPPPVNVDSKPIEEKTVEVNDRKAEFPSSGSNSVL
NTPPTTPESPSSVTVTEGSRQQSSVTVSEPLAPNQEEVRSIKSETDSTIEVDSVAGELQD
LQSEGNSSPAGFDASVSSSSSNQPEPEHPEKACTGQKRVKDAQGGGSSSKKQKRSHKATV
VNNKKKGKGTNSSDSEELSAGESITKSQPVKSVSTGMKSHSTKSPARTQSPGKCGKNGDK
DPDLKEPSNRLPKVYKWSFQMSDLENMTSAERITILQEKLQEIRKHYLSLKSEVASIDRR
RKRLKKKERESAATSSSSSSPSSSSITAAVMLTLAEPSMSSASQNGMSVECR
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcccttgatgagcctccctatttgacagtgggcactgatgtgagtgctaaatac
agaggagccttttgtgaagccaagatcaagacagcaaaaagacttgtcaaagtcaaggtg
acatttagacatgattcttcaacagtggaagttcaggatgaccacataaagggcccacta
aaggtaggagctattgtggaagtgaagaatcttgatggtgcatatcaggaagctgttatc
aataaactaacagatgcgagttggtacactgtagtttttgatgacggagatgagaagaca
ctgagacgatcttcactgtgcctgaaaggagagaggcattttgctgaaagtgaaacatta
gaccagctcccactcaccaaccctgagcattttggcactccagtcataggaaagaaaaca
aatagaggaagaagatctaatcatataccagaggaagagtcttcatcatcctccagtgat
gaagatgaggatgataggaaacagattgatgagctactaggcaaagttgtatgtgtagat
tacattagtttggataaaaagaaagcactgtggtttcctgcattggtggtttgtcctgat
tgtagtgatgagattgctgtaaaaaaggacaatattcttgttcgatctttcaaagatgga
aaatttacttcagttccaagaaaagatgtccatgaaattactagtgacactgcaccaaag
cctgatgctgttttaaagcaagcctttgaacaggcacttgaatttcacaaaagtagaact
attcctgctaactggaagactgaattgaaagaagatagctctagcagtgaagcagaggaa
gaagaggaggaggaagatgatgaaaaagaaaaggaggataatagcagtgaagaagaagaa
gaaatagaaccatttccagaagaaagggagaactttcttcagcaattgtacaaatttatg
gaagatagaggtacacctattaacaaacgacctgtacttggatatcgaaatttgaatctc
tttaagttattcagacttgtacacaaacttggaggatttgataatattgaaagtggagct
gtttggaaacaagtctaccaagatcttggaatccctgtcttaaattcagctgcaggatac
aatgttaaatgtgcttataaaaaatacttatatggttttgaggagtactgtagatcagcc
aacattgaatttcagatggcattgccagagaaagttgttaacaagcaatgtaaggagtgt
gaaaatgtaaaagaaataaaagttaaggaggaaaatgaaacagagatcaaagaaataaag
atggaggaggagaggaatataataccaagagaagaaaagcctattgaggatgaaattgaa
agaaaagaaaatattaagccctctctgggaagtaaaaagaatttattagaatctatacct
acacattctgatcaggaaaaagaagttaacattaaaaaaccagaagacaatgaaaatctg
gatgacaaagatgatgacacaactagggtagatgaatccctcaacataaaggtagaagct
gaggaagaaaaagcaaaatctggagatgaaacgaataaagaagaagatgaagatgatgaa
gaagcagaagaggaggaggaggaggaagaagaagaagaggatgaagatgatgatgacaac
aatgaggaagaggagtttgagtgctatccaccaggcatgaaagtccaagtgcggtatgga
cgagggaaaaatcaaaaaatgtatgaagctagtattaaagattctgatgtcgaaggtgga
gaggtcctttacttggtgcattactgcggatggaatgtgagatacgatgaatggattaaa
gcagataaaatagtaagacctgctgataaaaatgtgccaaagataaaacatcggaagaaa
ataaagaataaattagacaaagaaaaagacaaagatgaaaaatactctccaaaaaactgt
aaacttcggcgcttgtccaaaccaccatttcagacaaatccatctcctgaaatggtatcc
aaactggatctcactgatgccaaaaactctgatactgctcatattaagtccatagaaatt
acttcgatccttaatggacttcaagcttctgaaagttctgctgaagacagtgagcaggaa
gatgagagaggtgctcaagacatggataataatggcaaagaggaatctaagattgatcat
ttgaccaacaacagaaatgatcttatttcaaaggaggaacagaacagttcatctttgcta
gaagaaaacaaagttcatgcagatttggtaatatccaaaccagtgtcaaaatctccagaa
agattaaggaaagatatagaagtattatccgaagatactgattatgaagaagatgaagtc
acaaaaaagagaaaggatgtcaagaaggacacaacagataaatcttcaaaaccacaaata
aaacgtggtaaaagaaggtattgcaatacagaagagtgtctaaaaactggatcacctggc
aaaaaggaagagaaggccaagaacaaagaatcactttgcatggaaaacagtagcaacagc
tcttcagatgaagatgaagaagaaacaaaagcaaagatgacaccaactaagaaatacaat
ggtttggaggaaaaaagaaaatctctacggacaactggtttctattcaggattttcagaa
gtggcagaaaaaaggattaaacttttaaataactctgatgaaagacttcaaaacagcagg
gccaaagatcgaaaagatgtctggtcaagtattcagggacagtggcctaaaaaaacgctg
aaagagcttttttcagactctgatactgaggctgcagcttccccaccgcatcctgcccca
gaggagggggtggcagaggagtcactgcagactgtggctgaagaggagagttgttcaccc
agtgtagaactagaaaaaccacctccagtcaatgtcgatagtaaacccattgaagaaaaa
acagtagaggtcaatgacagaaaagcagaatttccaagtagtggcagtaattcagtgcta
aatacccctcctactacacctgaatcgccttcatcagtcactgtaacagaaggcagccgg
cagcagtcttctgtaacagtatcagaaccactggctccaaaccaagaagaggttcgaagt
atcaagagtgaaactgatagcacaattgaggtggatagtgttgctggggagctccaagac
ctccagtctgaagggaatagctcgccagcaggttttgatgccagtgtgagctcaagcagt
agtaatcagccagaaccagaacatcctgaaaaagcctgtacaggtcagaaaagagtgaaa
gatgctcagggaggaggaagttcatcaaaaaagcagaaaagaagccataaagcaacagtg
gtaaacaacaaaaagaagggaaaaggcacaaatagtagtgatagtgaagaactttcagct
ggtgaaagtataactaagagtcagccagtcaaatcagtttccactggaatgaagtctcat
agtaccaaatctcccgcaaggacgcagtctccaggaaaatgtggaaagaatggtgataag
gatcctgatctcaaggaacccagtaatcgattacccaaagtttacaaatggagttttcag
atgtcggacctggaaaatatgacaagtgccgaacgcatcacaattcttcaagaaaaactt
caagaaatcagaaaacattatctgtcattaaaatctgaagtagcttccattgatcggagg
agaaagcgtttaaagaagaaagagagagaaagtgctgctacatcctcatcctcctcttca
ccttcatccagttccataacagctgctgttatgttaactttagctgaaccgtcaatgtcc
agcgcatcacaaaatggaatgtcagttgagtgcaggtga

DBGET integrated database retrieval system