KEGG   Homo sapiens (human): 51744Help
Entry
51744             CDS       T01001                                 

Gene name
CD244, 2B4, NAIL, NKR2B4, Nmrk, SLAMF4
Definition
CD244 molecule, natural killer cell receptor 2B4
Orthology
K06582  
natural killer cell receptor 2B4
Organism
hsa  Homo sapiens (human)
Pathway
Natural killer cell mediated cytotoxicity
Class
Organismal Systems; Immune system; Natural killer cell mediated cytotoxicity [PATH:hsa04650]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23.3
AA seq 370 aa AA seqDB search
MLGQVVTLILLLLLKVYQGKGCQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQ
NGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTAT
FQVFVFESLLPDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAG
NLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPFLVIIVILSAL
FLGTLACFCVWRRKRKEKQSETSPKEFLTIYEDVKDLKTRRNHEQEQTFPGGGSTIYSMI
QSQSSAPTSQEPAYTLYSLIQPSRKSGSRKRNHSPSFNSTIYEVIGKSQPKAQNPARLSR
KELENFDVYS
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgctggggcaagtggtcaccctcatactcctcctgctcctcaaggtgtatcagggcaaa
ggatgccagggatcagctgaccatgtggttagcatctcgggagtgcctcttcagttacaa
ccaaacagcatacagacgaaggttgacagcattgcatggaagaagttgctgccctcacaa
aatggatttcatcacatattgaagtgggagaatggctctttgccttccaatacttccaat
gatagattcagttttatagtcaagaacttgagtcttctcatcaaggcagctcagcagcag
gacagtggcctctactgcctggaggtcaccagtatatctggaaaagttcagacagccacg
ttccaggtttttgtatttgaatctctgcttccagataaagttgagaaaccccgcctacag
gggcaggggaagatcctggacagagggagatgccaagtggctctgtcttgcttggtctcc
agggatggcaatgtgtcctatgcttggtacagagggagcaagctgatccagacagcaggg
aacctcacctacctggacgaggaggttgacattaatggcactcacacatatacctgcaat
gtcagcaatcctgttagctgggaaagccacaccctgaatctcactcaggactgtcagaat
gcccatcaggaattcagattttggccgtttttggtgatcatcgtgattctaagcgcactg
ttccttggcacccttgcctgcttctgtgtgtggaggagaaagaggaaggagaagcagtca
gagaccagtcccaaggaatttttgacaatttacgaagatgtcaaggatctgaaaaccagg
agaaatcacgagcaggagcagacttttcctggaggggggagcaccatctactctatgatc
cagtcccagtcttctgctcccacgtcacaagaacctgcatatacattatattcattaatt
cagccttccaggaagtctggatccaggaagaggaaccacagcccttccttcaatagcact
atctatgaagtgattggaaagagtcaacctaaagcccagaaccctgctcgattgagccgc
aaagagctggagaactttgatgtttattcctag

DBGET integrated database retrieval system