KEGG   Homo sapiens (human): 51755Help
Entry
51755             CDS       T01001                                 

Gene name
CDK12, CRK7, CRKR, CRKRS
Definition
cyclin-dependent kinase 12 (EC:2.7.11.23 2.7.11.22)
Orthology
K08819  
cyclin-dependent kinase 12/13 [EC:2.7.11.22 2.7.11.23]
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17q12
AA seq 1481 aa AA seqDB search
MPNSERHGGKKDGSGGASGTLQPSSGGGSSNSRERHRLVSKHKRHKSKHSKDMGLVTPEA
ASLGTVIKPLVEYDDISSDSDTFSDDMAFKLDRRENDERRGSDRSDRLHKHRHHQHRRSR
DLLKAKQTEKEKSQEVSSKSGSMKDRISGSSKRSNEETDDYGKAQVAKSSSKESRSSKLH
KEKTRKERELKSGHKDRSKSHRKRETPKSYKTVDSPKRRSRSPHRKWSDSSKQDDSPSGA
SYGQDYDLSPSRSHTSSNYDSYKKSPGSTSRRQSVSPPYKEPSAYQSSTRSPSPYSRRQR
SVSPYSRRRSSSYERSGSYSGRSPSPYGRRRSSSPFLSKRSLSRSPLPSRKSMKSRSRSP
AYSRHSSSHSKKKRSSSRSRHSSISPVRLPLNSSLGAELSRKKKERAAAAAAAKMDGKES
KGSPVFLPRKENSSVEAKDSGLESKKLPRSVKLEKSAPDTELVNVTHLNTEVKNSSDTGK
VKLDENSEKHLVKDLKAQGTRDSKPIALKEEIVTPKETETSEKETPPPLPTIASPPPPLP
TTTPPPQTPPLPPLPPIPALPQQPPLPPSQPAFSQVPASSTSTLPPSTHSKTSAVSSQAN
SQPPVQVSVKTQVSVTAAIPHLKTSTLPPLPLPPLLPGDDDMDSPKETLPSKPVKKEKEQ
RTRHLLTDLPLPPELPGGDLSPPDSPEPKAITPPQQPYKKRPKICCPRYGERRQTESDWG
KRCVDKFDIIGIIGEGTYGQVYKAKDKDTGELVALKKVRLDNEKEGFPITAIREIKILRQ
LIHRSVVNMKEIVTDKQDALDFKKDKGAFYLVFEYMDHDLMGLLESGLVHFSEDHIKSFM
KQLMEGLEYCHKKNFLHRDIKCSNILLNNSGQIKLADFGLARLYNSEESRPYTNKVITLW
YRPPELLLGEERYTPAIDVWSCGCILGELFTKKPIFQANLELAQLELISRLCGSPCPAVW
PDVIKLPYFNTMKPKKQYRRRLREEFSFIPSAALDLLDHMLTLDPSKRCTAEQTLQSDFL
KDVELSKMAPPDLPHWQDCHELWSKKRRRQRQSGVVVEEPPPSKTSRKETTSGTSTEPVK
NSSPAPPQPAPGKVESGAGDAIGLADITQQLNQSELAVLLNLLQSQTDLSIPQMAQLLNI
HSNPEMQQQLEALNQSISALTEATSQQQDSETMAPEESLKEAPSAPVILPSAEQTTLEAS
STPADMQNILAVLLSQLMKTQEPAGSLEENNSDKNSGPQGPRRTPTMPQEEAAEKRPPEP
PGPPPPPPPPPLVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYS
TRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSY
QGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTG
ASSSGAGLHWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY
NT seq 4446 nt NT seq  +upstreamnt  +downstreamnt
atgcccaattcagagagacatgggggcaagaaggacgggagtggaggagcttctggaact
ttgcagccgtcatcgggaggcggcagctctaacagcagagagcgtcaccgcttggtatcg
aagcacaagcggcataagtccaaacactccaaagacatggggttggtgacccccgaagca
gcatccctgggcacagttatcaaacctttggtggagtatgatgatatcagctctgattcc
gacaccttctccgatgacatggccttcaaactagaccgaagggagaacgacgaacgtcgt
ggatcagatcggagcgaccgcctgcacaaacatcgtcaccaccagcacaggcgttcccgg
gacttactaaaagctaaacagaccgaaaaagaaaaaagccaagaagtctccagcaagtcg
ggatcgatgaaggaccggatatcgggaagttcaaagcgttcgaatgaggagactgatgac
tatgggaaggcgcaggtagccaaaagcagcagcaaggaatccaggtcatccaagctccac
aaggagaagaccaggaaagaacgggagctgaagtctgggcacaaagaccggagtaaaagt
catcgaaaaagggaaacacccaaaagttacaaaacagtggacagcccaaaacggagatcc
aggagcccccacaggaagtggtctgacagctccaaacaagatgatagcccctcgggagct
tcttatggccaagattatgaccttagtccctcacgatctcatacctcgagcaattatgac
tcctacaagaaaagtcctggaagtacctcgagaaggcagtcggtcagtcccccttacaag
gagccttcggcctaccagtccagcacccggtcaccgagcccctacagtaggcgacagaga
tctgtcagtccctatagcaggagacggtcgtccagctacgaaagaagtggctcttacagc
gggcgatcgcccagtccctatggtcgaaggcggtccagcagccctttcctgagcaagcgg
tctctgagtcggagtccactccccagtaggaaatccatgaagtccagaagtagaagtcct
gcatattcaagacattcatcttctcatagtaaaaagaagagatccagttcacgcagtcgt
cattccagtatctcacctgtcaggcttccacttaattccagtctgggagctgaactcagt
aggaaaaagaaggaaagagcagctgctgctgctgcagcaaagatggatggaaaggagtcc
aagggttcacctgtatttttgcctagaaaagagaacagttcagtagaggctaaggattca
ggtttggagtctaaaaagttacccagaagtgtaaaattggaaaaatctgccccagatact
gaactggtgaatgtaacacatctaaacacagaggtaaaaaattcttcagatacagggaaa
gtaaagttggatgagaactccgagaagcatcttgttaaagatttgaaagcacagggaaca
agagactctaaacccatagcactgaaagaggagattgttactccaaaggagacagaaaca
tcagaaaaggagacccctccacctcttcccacaattgcttctcccccaccccctctacca
actactacccctccacctcagacaccccctttgccacctttgcctccaataccagctctt
ccacagcaaccacctctgcctccttctcagccagcatttagtcaggttcctgcttccagt
acttcaactttgcccccttctactcactcaaagacatctgctgtgtcctctcaggcaaat
tctcagccccctgtacaggtttctgtgaagactcaagtatctgtaacagctgctattcca
cacctgaaaacttcaacgttgcctcctttgcccctcccacccttattacctggagatgat
gacatggatagtccaaaagaaactcttccttcaaaacctgtgaagaaagagaaggaacag
aggacacgtcacttactcacagaccttcctctccctccagagctccctggtggagatctg
tctcccccagactctccagaaccaaaggcaatcacaccacctcagcaaccatataaaaag
agaccaaaaatttgttgtcctcgttatggagaaagaagacaaacagaaagcgactggggg
aaacgctgtgtggacaagtttgacattattgggattattggagaaggaacctatggccaa
gtatataaagccaaggacaaagacacaggagaactagtggctctgaagaaggtgagacta
gacaatgagaaagagggcttcccaatcacagccattcgtgaaatcaaaatccttcgtcag
ttaatccaccgaagtgttgttaacatgaaggaaattgtcacagataaacaagatgcactg
gatttcaagaaggacaaaggtgccttttaccttgtatttgagtatatggaccatgactta
atgggactgctagaatctggtttggtgcacttttctgaggaccatatcaagtcgttcatg
aaacagctaatggaaggattggaatactgtcacaaaaagaatttcctgcatcgggatatt
aagtgttctaacattttgctgaataacagtgggcaaatcaaactagcagattttggactt
gctcggctctataactctgaagagagtcgcccttacacaaacaaagtcattactttgtgg
taccgacctccagaactactgctaggagaggaacgttacacaccagccatagatgtttgg
agctgtggatgtattcttggggaactattcacaaagaagcctatttttcaagccaatctg
gaactggctcagctagaactgatcagccgactttgtggtagcccttgtccagctgtgtgg
cctgatgttatcaaactgccctacttcaacaccatgaaaccgaagaagcaatatcgaagg
cgtctacgagaagaattctctttcattccttctgcagcacttgatttattggaccacatg
ctgacactagatcctagtaagcggtgcacagctgaacagaccctacagagcgacttcctt
aaagatgtcgaactcagcaaaatggctcctccagacctcccccactggcaggattgccat
gagttgtggagtaagaaacggcgacgtcagcgacaaagtggtgttgtagtcgaagagcca
cctccatccaaaacttctcgaaaagaaactacctcagggacaagtactgagcctgtgaag
aacagcagcccagcaccacctcagcctgctcctggcaaggtggagtctggggctggggat
gcaataggccttgctgacatcacacaacagctgaatcaaagtgaattggcagtgttatta
aacctgctgcagagccaaaccgacctgagcatccctcaaatggcacagctgcttaacatc
cactccaacccagagatgcagcagcagctggaagccctgaaccaatccatcagtgccctg
acggaagctacttcccagcagcaggactcagagaccatggccccagaggagtctttgaag
gaagcaccctctgccccagtgatcctgccttcagcagaacagacgacccttgaagcttca
agcacaccagctgacatgcagaatatattggcagttctcttgagtcagctgatgaaaacc
caagagccagcaggcagtctggaggaaaacaacagtgacaagaacagtgggccacagggg
ccccgaagaactcccacaatgccacaggaggaggcagcagagaagaggccccctgagccc
cccggacctccaccgccgccacctccaccccctctggttgaaggcgatctttccagcgcc
ccccaggagttgaacccagccgtgacagccgccttgctgcaacttttatcccagcctgaa
gcagagcctcctggccacctgccacatgagcaccaggccttgagaccaatggagtactcc
acccgaccccgtccaaacaggacttatggaaacactgatgggcctgaaacagggttcagt
gccattgacactgatgaacgaaactctggtccagccttgacagaatccttggtccagacc
ctggtgaagaacaggaccttctcaggctctctgagccaccttggggagtccagcagttac
cagggcacagggtcagtgcagtttccaggggaccaggacctccgttttgccagggtcccc
ttagcgttacacccggtggtcgggcaaccattcctgaaggctgagggaagcagcaattct
gtggtacatgcagagaccaaattgcaaaactatggggagctggggccaggaaccactggg
gccagcagctcaggagcaggccttcactgggggggcccaactcagtcttctgcttatgga
aaactctatcgggggcctacaagagtcccaccaagagggggaagagggagaggagttcct
tactaa

DBGET integrated database retrieval system