KEGG   Homo sapiens (human): 51763Help
Entry
51763             CDS       T01001                                 

Gene name
INPP5K, PPS, SKIP
Definition
inositol polyphosphate-5-phosphatase K (EC:3.1.3.56)
Orthology
K01106  
inositol-1,4,5-trisphosphate 5-phosphatase [EC:3.1.3.56]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Insulin signaling pathway
Module
Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    51763 (INPP5K)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    51763 (INPP5K)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    51763 (INPP5K)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.56  inositol-polyphosphate 5-phosphatase
     51763 (INPP5K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
17p13.3
AA seq 372 aa AA seqDB search
MDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICL
KLYGYYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFR
IEDFGLHFVRESIKNRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDY
DTSEKKRKPAWTDRILWRLKRQPCAGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSG
TFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYSSTSDFPSSPWDWIGLYKVGLRDVNDY
VSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLRSVVGISRPFQIPPGSL
REDPLGEAQPQI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggatgtgctttcccctctgagcttcatcaaggtctcccatgtccgtatgcaggggatc
ctcttactggtctttgccaagtatcagcatttgccctatatccagattctgtctactaaa
tccacccccactggcctgtttgggtactgggggaacaaaggtggagtcaacatctgcctg
aagctttatggctactatgtcagcatcatcaactgccacctgcctccccacatttccaac
aattaccagcggctggagcactttgaccggatcctggagatgcagaattgtgaggggcga
gacatcccaaacatcctggaccacgacctcattatctggtttggagacatgaactttcgg
atcgaggactttgggttgcactttgttcgggaatccattaaaaatcggtgctacggtggc
ctgtgggagaaggaccagctcagcattgccaagaaacatgacccgctgctccgggagttc
caggagggccgcctactcttcccgcccacctacaagtttgataggaactccaacgactat
gacaccagtgagaaaaaacgcaagcctgcatggaccgatcgcatcctgtggaggctgaag
cggcagccctgtgctggccccgacactcccataccgccggcgtcacacttctccttgtct
ctgaggggctacagcagccacatgacgtacggcatcagcgaccacaagcctgtctccggc
acgttcgacttggagctgaagccattggtgtctgctccgctgatcgtcctgatgcccgag
gacctgtggaccgtggaaaatgacatgatggtcagctactcttcaacctcggacttcccc
agcagcccgtgggactggattggactgtacaaggtggggctgcgggacgttaatgactac
gtgtcctatgcctgggtcggggacagcaaggtctcctgcagcgacaacctgaaccaggtt
tacatcgacatcagcaatatccctaccactgaagatgagtttctcctctgttactacagc
aacagtctgcgttctgtggtggggataagcagacccttccagatcccgcctggctccttg
agggaggacccactgggtgaagcacagccacagatctga

DBGET integrated database retrieval system