KEGG   Homo sapiens (human): 51764Help
Entry
51764             CDS       T01001                                 

Gene name
GNG13, G(gamma)13, h2-35
Definition
guanine nucleotide binding protein (G protein), gamma 13
Orthology
K04547  
guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-13
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Chemokine signaling pathway
PI3K-Akt signaling pathway
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Taste transduction
Morphine addiction
Alcoholism
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    51764 (GNG13)
   04151 PI3K-Akt signaling pathway
    51764 (GNG13)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    51764 (GNG13)
  Nervous system
   04724 Glutamatergic synapse
    51764 (GNG13)
   04727 GABAergic synapse
    51764 (GNG13)
   04725 Cholinergic synapse
    51764 (GNG13)
   04728 Dopaminergic synapse
    51764 (GNG13)
   04726 Serotonergic synapse
    51764 (GNG13)
   04723 Retrograde endocannabinoid signaling
    51764 (GNG13)
  Sensory system
   04742 Taste transduction
    51764 (GNG13)
  Environmental adaptation
   04713 Circadian entrainment
    51764 (GNG13)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    51764 (GNG13)
  Substance dependence
   05032 Morphine addiction
    51764 (GNG13)
   05034 Alcoholism
    51764 (GNG13)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    51764 (GNG13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 67 aa AA seqDB search
MEEWDVPQMKKEVESLKYQLAFQREMASKTIPELLKWIEDGIPKDPFLNPDLMKNNPWVE
KGKCTIL
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atggaggagtgggacgtgccacagatgaagaaagaggtggagagcctcaagtaccagctg
gccttccagcgggagatggcgtccaagaccatccccgagctgctgaagtggatcgaggac
gggatccccaaggaccccttcctgaaccccgacctgatgaagaacaacccatgggtggaa
aagggcaaatgcaccatcctgtga

DBGET integrated database retrieval system