KEGG   Homo sapiens (human): 51776Help
Entry
51776             CDS       T01001                                 

Gene name
ZAK, AZK, MLK7, MLT, MLTK, MRK, mlklak, pk
Definition
sterile alpha motif and leucine zipper containing kinase AZK (EC:2.7.11.25)
Orthology
K04424  
sterile alpha motif and leucine zipper containing kinase AZK [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Tight junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    51776 (ZAK)
 Cellular Processes
  Cellular commiunity
   04530 Tight junction
    51776 (ZAK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     51776 (ZAK)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   51776 (ZAK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24.2
AA seq 800 aa AA seqDB search
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVL
SHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
LHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQS
LPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLH
QCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERD
LSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFEIGAWTEDDVYCWVQQLVRKGDSSAE
MSVYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFKSAIEKLTHDYINLFHFPPL
IKDSGGEPEENEEKIVNLELVFGFHLKPGTGPQDCKWKMYMEMDGDEIAITYIKDVTFNT
NLPDAEILKMTKPPFVMEKWIVGIAKSQTVECTVTYESDVRTPKSTKHVHSIQWSRTKPQ
DEVKAVQLAIQTLFTNSDGNPGSRSDSSADCQWLDTLRMRQIASNTSLQRSQSNPILGSP
FFSHFDGQDSYAAAVRRPQVPIKYQQITPVNQSRSSSPTQYGLTKNFSSLHLNSRDSGFS
SGNTDTSSERGRYSDRSRNKYGRGSISLNSSPRGRYSGKSQHSTPSRGRYPGKFYRVSQS
ALNPHQSPDFKRSPRDLHQPNTIPGMPLHPETDSRASEEDSKVSEGGWTKVEYRKKPHRP
SPAKTNKERARGDHRGWRNF
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctctcggtgcctcctttgtgcaaattaaatttgatgacttgcagttttttgaa
aactgcggtggaggaagttttgggagtgtttatcgagccaaatggatatcacaggacaag
gaggtggctgtaaagaagctcctcaaaatagagaaagaggcagaaatactcagtgtcctc
agtcacagaaacatcatccagttttatggagtaattcttgaacctcccaactatggcatt
gtcacagaatatgcttctctgggatcactctatgattacattaacagtaacagaagtgag
gagatggatatggatcacattatgacctgggccactgatgtagccaaaggaatgcattat
ttacatatggaggctcctgtcaaggtgattcacagagacctcaagtcaagaaacgttgtt
atagctgctgatggagtattgaagatctgtgactttggtgcctctcggttccataaccat
acaacacacatgtccttggttggaactttcccatggatggctccagaagttatccagagt
ctccctgtgtcagaaacttgtgacacatattcctatggtgtggttctctgggagatgcta
acaagggaggtcccctttaaaggtttggaaggattacaagtagcttggcttgtagtggaa
aaaaacgagagattaaccattccaagcagttgccccagaagttttgctgaactgttacat
cagtgttgggaagctgatgccaagaaacggccatcattcaagcaaatcatttcaatcctg
gagtccatgtcaaatgacacgagccttcctgacaagtgtaactcattcctacacaacaag
gcggagtggaggtgcgaaattgaggcaactcttgagaggctaaagaaactagagcgtgat
ctcagctttaaggagcaggagcttaaagaacgagaaagacgtttaaagatgtgggagcaa
aagctgacagagcagtccaacaccccgctgctgccttcctttgagattggtgcatggacg
gaagacgatgtgtattgttgggttcagcagctcgtcagaaaaggtgactcttcagcagag
atgagtgtatatgcaagcttgtttaaagaaaacaacattacagggaagcggctgctgctg
ctggaggaagaagacctgaaagacatgggcattgtctccaaggggcatatcattcacttc
aagtcagccattgagaaattaacccatgattacataaatttgtttcacttcccaccacta
attaaggactcaggaggtgaacctgaagaaaatgaggaaaaaatagtgaacctggaactg
gtttttggttttcacttgaaaccaggaactggcccacaggattgtaagtggaaaatgtat
atggagatggatggggatgaaattgcaataacctacataaaagatgtgacattcaacact
aacctacctgatgcggagattttaaagatgacaaagccaccatttgtaatggagaagtgg
attgtaggaatagcaaaaagtcagactgtggagtgcactgtcacatatgagagtgatgtt
agaactccaaaaagcactaaacatgtccattcgattcagtggagtagaacaaaacctcag
gatgaagtgaaagcagtccaacttgccattcagacattattcaccaattcagatggcaac
cctggaagcaggtccgactcaagtgctgattgccagtggttagatactctgaggatgcgg
cagattgcatccaacacttctttacagcgttcccagagcaatcctattctggggtcaccg
ttcttctcacactttgatggccaggattcctacgctgctgctgtgagacggccccaggtg
cccattaagtatcaacagattacacctgtgaaccagtccagaagctcgtctcctactcag
tatggactgaccaaaaacttctcttccctacatctcaactctagggacagtggcttttcc
agtggcaatactgacacctcttcagagaggggtcgatactcagacagaagcaggaacaaa
tatggacgtggtagtatatcactcaattcttctcctagaggaagatacagtggaaagagt
cagcattccactccttcaagaggaagataccctggaaagttctacagggtttctcagtca
gcactcaatcctcaccagtcgcctgacttcaagagaagccccagggacctccaccaaccc
aacaccataccagggatgcctttgcaccctgagactgactcaagagccagtgaagaggac
agcaaagtcagcgaagggggctggacaaaagtggaataccggaaaaagccccacaggcca
tctcccgccaaaaccaataaagagagagccagaggggaccaccgtggatggagaaacttt
tga

DBGET integrated database retrieval system