KEGG   Homo sapiens (human): 51776Help
Entry
51776             CDS       T01001                                 

Gene name
ZAK, AZK, MLK7, MLT, MLTK, MRK, mlklak, pk
Definition
sterile alpha motif and leucine zipper containing kinase AZK (EC:2.7.11.25)
Orthology
K04424  
sterile alpha motif and leucine zipper containing kinase AZK [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
MAPK signaling pathway
Tight junction
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:hsa04010]
Cellular Processes; Cell communication; Tight junction [PATH:hsa04530]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2q24.2
AA seq 800 aa AA seqDB search
MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVL
SHRNIIQFYGVILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHY
LHMEAPVKVIHRDLKSRNVVIAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQS
LPVSETCDTYSYGVVLWEMLTREVPFKGLEGLQVAWLVVEKNERLTIPSSCPRSFAELLH
QCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNKAEWRCEIEATLERLKKLERD
LSFKEQELKERERRLKMWEQKLTEQSNTPLLPSFEIGAWTEDDVYCWVQQLVRKGDSSAE
MSVYASLFKENNITGKRLLLLEEEDLKDMGIVSKGHIIHFKSAIEKLTHDYINLFHFPPL
IKDSGGEPEENEEKIVNLELVFGFHLKPGTGPQDCKWKMYMEMDGDEIAITYIKDVTFNT
NLPDAEILKMTKPPFVMEKWIVGIAKSQTVECTVTYESDVRTPKSTKHVHSIQWSRTKPQ
DEVKAVQLAIQTLFTNSDGNPGSRSDSSADCQWLDTLRMRQIASNTSLQRSQSNPILGSP
FFSHFDGQDSYAAAVRRPQVPIKYQQITPVNQSRSSSPTQYGLTKNFSSLHLNSRDSGFS
SGNTDTSSERGRYSDRSRNKYGRGSISLNSSPRGRYSGKSQHSTPSRGRYPGKFYRVSQS
ALNPHQSPDFKRSPRDLHQPNTIPGMPLHPETDSRASEEDSKVSEGGWTKVEYRKKPHRP
SPAKTNKERARGDHRGWRNF
NT seq 2403 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctctcggtgcctcctttgtgcaaattaaatttgatgacttgcagttttttgaa
aactgcggtggaggaagttttgggagtgtttatcgagccaaatggatatcacaggacaag
gaggtggctgtaaagaagctcctcaaaatagagaaagaggcagaaatactcagtgtcctc
agtcacagaaacatcatccagttttatggagtaattcttgaacctcccaactatggcatt
gtcacagaatatgcttctctgggatcactctatgattacattaacagtaacagaagtgag
gagatggatatggatcacattatgacctgggccactgatgtagccaaaggaatgcattat
ttacatatggaggctcctgtcaaggtgattcacagagacctcaagtcaagaaacgttgtt
atagctgctgatggagtattgaagatctgtgactttggtgcctctcggttccataaccat
acaacacacatgtccttggttggaactttcccatggatggctccagaagttatccagagt
ctccctgtgtcagaaacttgtgacacatattcctatggtgtggttctctgggagatgcta
acaagggaggtcccctttaaaggtttggaaggattacaagtagcttggcttgtagtggaa
aaaaacgagagattaaccattccaagcagttgccccagaagttttgctgaactgttacat
cagtgttgggaagctgatgccaagaaacggccatcattcaagcaaatcatttcaatcctg
gagtccatgtcaaatgacacgagccttcctgacaagtgtaactcattcctacacaacaag
gcggagtggaggtgcgaaattgaggcaactcttgagaggctaaagaaactagagcgtgat
ctcagctttaaggagcaggagcttaaagaacgagaaagacgtttaaagatgtgggagcaa
aagctgacagagcagtccaacaccccgctgctgccttcctttgagattggtgcatggacg
gaagacgatgtgtattgttgggttcagcagctcgtcagaaaaggtgactcttcagcagag
atgagtgtatatgcaagcttgtttaaagaaaacaacattacagggaagcggctgctgctg
ctggaggaagaagacctgaaagacatgggcattgtctccaaggggcatatcattcacttc
aagtcagccattgagaaattaacccatgattacataaatttgtttcacttcccaccacta
attaaggactcaggaggtgaacctgaagaaaatgaggaaaaaatagtgaacctggaactg
gtttttggttttcacttgaaaccaggaactggcccacaggattgtaagtggaaaatgtat
atggagatggatggggatgaaattgcaataacctacataaaagatgtgacattcaacact
aacctacctgatgcggagattttaaagatgacaaagccaccatttgtaatggagaagtgg
attgtaggaatagcaaaaagtcagactgtggagtgcactgtcacatatgagagtgatgtt
agaactccaaaaagcactaaacatgtccattcgattcagtggagtagaacaaaacctcag
gatgaagtgaaagcagtccaacttgccattcagacattattcaccaattcagatggcaac
cctggaagcaggtccgactcaagtgctgattgccagtggttagatactctgaggatgcgg
cagattgcatccaacacttctttacagcgttcccagagcaatcctattctggggtcaccg
ttcttctcacactttgatggccaggattcctacgctgctgctgtgagacggccccaggtg
cccattaagtatcaacagattacacctgtgaaccagtccagaagctcgtctcctactcag
tatggactgaccaaaaacttctcttccctacatctcaactctagggacagtggcttttcc
agtggcaatactgacacctcttcagagaggggtcgatactcagacagaagcaggaacaaa
tatggacgtggtagtatatcactcaattcttctcctagaggaagatacagtggaaagagt
cagcattccactccttcaagaggaagataccctggaaagttctacagggtttctcagtca
gcactcaatcctcaccagtcgcctgacttcaagagaagccccagggacctccaccaaccc
aacaccataccagggatgcctttgcaccctgagactgactcaagagccagtgaagaggac
agcaaagtcagcgaagggggctggacaaaagtggaataccggaaaaagccccacaggcca
tctcccgccaaaaccaataaagagagagccagaggggaccaccgtggatggagaaacttt
tga

DBGET integrated database retrieval system