KEGG   Homo sapiens (human): 51778Help
Entry
51778             CDS       T01001                                 

Gene name
MYOZ2, C4orf5, CMH16, CS-1
Definition
myozenin 2
Organism
hsa  Homo sapiens (human)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4q26-q27
AA seq 264 aa AA seqDB search
MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKM
RQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNP
DNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELP
DYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWI
SENIPIVITTEPTDDTTVPESEDL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctatcacataatactatgatgaagcagagaaaacagcaagcaacagccatcatgaag
gaagtccatggaaatgatgttgatggcatggacctgggcaaaaaggtcagcatccccaga
gacatcatgttggaagaattatcccatctcagtaaccgtggtgccaggctatttaagatg
cgtcaaagaagatctgacaaatacacatttgaaaatttccagtatcaatctagagcacaa
ataaatcacagtattgctatgcagaatgggaaagtggatggaagtaacttggaaggtggt
tcgcagcaagcccccttgactcctcccaacaccccagatccacgaagccctccaaatcca
gacaacattgctccaggatattctggaccactgaaggaaattcctcctgaaaaattcaac
accacagctgtccctaagtactatcaatctccctgggaacaagccattagcaatgatccg
gagcttttagaggctttatatcctaaacttttcaagcctgaaggaaaggcagaactgcct
gattacaggagctttaacagggttgccacaccatttggaggttttgaaaaagcatcaaga
atggttaaatttaaagttccagattttgagctactattgctaacagatcccaggtttatg
tcctttgtcaatcccctttctggcagacggtcctttaataggactcctaagggatggata
tctgagaatattcctatagtgataacaaccgaacctacagatgataccactgtaccagaa
tcagaagacctatga

DBGET integrated database retrieval system