KEGG   Homo sapiens (human): 518Help
Entry
518               CDS       T01001                                 

Gene name
ATP5G3, P3
Definition
(RefSeq) ATP synthase, H+ transporting, mitochondrial Fo complex subunit C3 (subunit 9)
  KO
K02128  
F-type H+-transporting ATPase subunit c
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Alzheimer's disease
Parkinson's disease
Huntington's disease
Module
F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    518 (ATP5G3)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    518 (ATP5G3)
   05012 Parkinson's disease
    518 (ATP5G3)
   05016 Huntington's disease
    518 (ATP5G3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P48201(Tdark)
UniProt: 
Position
2q31.1
AA seq 142 aa AA seqDB search
MFACAKLACTPSLIRAGSRVAYRPISASVLSRPEASRTGEGSTVFNGAQNGVSQLIQREF
QTSAISRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILG
FALSEAMGLFCLMVAFLILFAM
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcctgcgccaagctcgcctgcaccccctctctgatccgagctggatccagagtt
gcatacagaccaatttctgcatcagtgttatctcgaccagaggctagtaggactggagag
ggctctacggtatttaatggggcccagaatggtgtgtctcagctaatccaaagggagttt
cagaccagtgcaatcagcagagacattgatactgctgccaaatttattggtgcaggtgct
gcaacagtaggagtggctggttctggtgctggtattggaacagtctttggcagccttatc
attggttatgccagaaacccttcgctgaagcagcagctgttctcatatgctatcctggga
tttgccttgtctgaagctatgggtctcttttgtttgatggttgctttcttgattttgttt
gccatgtaa

DBGET integrated database retrieval system