KEGG   Homo sapiens (human): 51806Help
Entry
51806             CDS       T01001                                 

Gene name
CALML5, CLSP
Definition
calmodulin-like 5
Orthology
K02183  
calmodulin
Organism
hsa  Homo sapiens (human)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Phosphatidylinositol signaling system
Oocyte meiosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Dopaminergic synapse
Olfactory transduction
Phototransduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Melanogenesis
Oxytocin signaling pathway
Salivary secretion
Gastric acid secretion
Alzheimer's disease
Amphetamine addiction
Alcoholism
Pertussis
Tuberculosis
Glioma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    51806 (CALML5)
   04015 Rap1 signaling pathway
    51806 (CALML5)
   04020 Calcium signaling pathway
    51806 (CALML5)
   04070 Phosphatidylinositol signaling system
    51806 (CALML5)
   04024 cAMP signaling pathway
    51806 (CALML5)
   04022 cGMP - PKG signaling pathway
    51806 (CALML5)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    51806 (CALML5)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    51806 (CALML5)
   04912 GnRH signaling pathway
    51806 (CALML5)
   04915 Estrogen signaling pathway
    51806 (CALML5)
   04921 Oxytocin signaling pathway
    51806 (CALML5)
   04916 Melanogenesis
    51806 (CALML5)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    51806 (CALML5)
   04270 Vascular smooth muscle contraction
    51806 (CALML5)
  Digestive system
   04970 Salivary secretion
    51806 (CALML5)
   04971 Gastric acid secretion
    51806 (CALML5)
  Nervous system
   04728 Dopaminergic synapse
    51806 (CALML5)
   04720 Long-term potentiation
    51806 (CALML5)
   04722 Neurotrophin signaling pathway
    51806 (CALML5)
  Sensory system
   04744 Phototransduction
    51806 (CALML5)
   04740 Olfactory transduction
    51806 (CALML5)
   04750 Inflammatory mediator regulation of TRP channels
    51806 (CALML5)
  Environmental adaptation
   04713 Circadian entrainment
    51806 (CALML5)
 Human Diseases
  Cancers
   05214 Glioma
    51806 (CALML5)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    51806 (CALML5)
  Substance dependence
   05031 Amphetamine addiction
    51806 (CALML5)
   05034 Alcoholism
    51806 (CALML5)
  Infectious diseases
   05133 Pertussis
    51806 (CALML5)
   05152 Tuberculosis
    51806 (CALML5)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     51806 (CALML5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   51806 (CALML5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p15.1
AA seq 146 aa AA seqDB search
MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDG
DGEISFQEFLTAAKKARAGLEDLQVAFRAFDQDGDGHITVDELRRAMAGLGQPLPQEELD
AMIREADVDQDGRVNYEEFARMLAQE
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggccggtgagctgactcctgaggaggaggcccagtacaaaaaggctttctccgcggtt
gacacggatggaaacggcaccatcaatgcccaggagctgggcgcggcgctgaaggccacg
ggcaagaacctctcggaggcccagctaaggaaactcatctccgaggttgacagcgacggc
gacggcgaaatcagcttccaggagttcctgacggcggcgaagaaggccagggccggcctg
gaggacctgcaggtcgccttccgcgccttcgaccaggatggcgacggccacatcaccgtg
gacgagctcaggcgggccatggcggggctggggcagccgctgccgcaggaggagctggac
gccatgatccgcgaggccgacgtggaccaggacgggcgggtgaactacgaggagttcgcg
aggatgctcgcccaggagtga

DBGET integrated database retrieval system