KEGG   Homo sapiens (human): 5189Help
Entry
5189              CDS       T01001                                 

Gene name
PEX1, PBD1A, PBD1B, ZWS, ZWS1
Definition
peroxisomal biogenesis factor 1
Orthology
K13338  
peroxin-1
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Disease
H00177  
Adrenoleukodystrophy, neonatal (NALD)
H00204  
Infantile Refsum disease (IRD)
H00205  
Peroxisome biogenesis disorder
H01342  
Zellweger syndrome (ZS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    5189 (PEX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.2
AA seq 1283 aa AA seqDB search
MWGSDRLAGAGGGGAAVTVAFTNARDCFLHLPRRLVAQLHLLQNQAIEVVWSHQPAFLSW
VEGRHFSDQGENVAEINRQVGQKLGLSNGGQVFLKPCSHVVSCQQVEVEPLSADDWEILE
LHAVSLEQHLLDQIRIVFPKAIFPVWVDQQTYIFIQIVALIPAASYGRLETDTKLLIQPK
TRRAKENTFSKADAEYKKLHSYGRDQKGMMKELQTKQLQSNTVGITESNENESEIPVDSS
SVASLWTMIGSIFSFQSEKKQETSWGLTEINAFKNMQSKVVPLDNIFRVCKSQPPSIYNA
SATSVFHKHCAIHVFPWDQEYFDVEPSFTVTYGKLVKLLSPKQQQSKTKQNVLSPEKEKQ
MSEPLDQKKIRSDHNEEDEKACVLQVVWNGLEELNNAIKYTKNVEVLHLGKVWIPDDLRK
RLNIEMHAVVRITPVEVTPKIPRSLKLQPRENLPKDISEEDIKTVFYSWLQQSTTTMLPL
VISEEEFIKLETKDGLKEFSLSIVHSWEKEKDKNIFLLSPNLLQKTTIQVLLDPMVKEEN
SEEIDFILPFLKLSSLGGVNSLGVSSLEHITHSLLGRPLSRQLMSLVAGLRNGALLLTGG
KGSGKSTLAKAICKEAFDKLDAHVERVDCKALRGKRLENIQKTLEVAFSEAVWMQPSVVL
LDDLDLIAGLPAVPEHEHSPDAVQSQRLAHALNDMIKEFISMGSLVALIATSQSQQSLHP
LLVSAQGVHIFQCVQHIQPPNQEQRCEILCNVIKNKLDCDINKFTDLDLQHVAKETGGFV
ARDFTVLVDRAIHSRLSRQSISTREKLVLTTLDFQKALRGFLPASLRSVNLHKPRDLGWD
KIGGLHEVRQILMDTIQLPAKYPELFANLPIRQRTGILLYGPPGTGKTLLAGVIARESRM
NFISVKGPELLSKYIGASEQAVRDIFIRAQAAKPCILFFDEFESIAPRRGHDNTGVTDRV
VNQLLTQLDGVEGLQGVYVLAATSRPDLIDPALLRPGRLDKCVYCPPPDQVSRLEILNVL
SDSLPLADDVDLQHVASVTDSFTGADLKALLYNAQLEALHGMLLSSGLQDGSSSSDSDLS
LSSMVFLNHSSGSDDSAGDGECGLDQSLVSLEMSEILPDESKFNMYRLYFGSSYESELGN
GTSSDLSSQCLSAPSSMTQDLPGVPGKDQLFSQPPVLRTASQEGCQELTQEQRDQLRADI
SIIKGRYRSQSGEDESMNQPGPIKTRLAISQSHLMTALGHTRPSISEDDWKNFAELYESF
QNPKRRKNQSGTMFRPGQKVTLA
NT seq 3852 nt NT seq  +upstreamnt  +downstreamnt
atgtggggcagcgatcgcctggcgggtgctgggggaggcggggcggcagtgactgtggcc
ttcaccaacgctcgcgactgcttcctccacctgccgcggcgtctcgtggcccagctgcat
ctgctgcagaatcaagctatagaagtggtctggagtcaccagcctgcattcttgagctgg
gtggaaggcaggcattttagtgatcaaggtgaaaatgtggctgaaattaacagacaagtt
ggtcaaaaacttggactctcaaatgggggacaggtatttctcaagccatgttcccatgtg
gtatcttgtcaacaagttgaggtggaacccctctcagcagatgattgggagatactggag
ctgcatgctgtttcccttgaacaacatcttctagatcaaattcgaatagtttttccaaaa
gccatttttcctgtttgggttgatcaacaaacgtacatatttatccaaattgttgcacta
ataccagctgcctcttatggaaggctggaaactgacaccaaactccttattcagccaaag
acacgccgagccaaagagaatacattttcaaaagctgatgctgaatataaaaaacttcat
agttatggaagagaccagaaaggaatgatgaaagaacttcaaaccaagcaacttcagtca
aatactgtgggaatcactgaatctaatgaaaacgagtcagagattccagttgactcatca
tcagtagcaagtttatggactatgataggaagcattttttcctttcaatctgagaagaaa
caagagacatcttggggtttaactgaaatcaatgcattcaaaaatatgcagtcaaaggtt
gttcctctagacaatattttcagagtatgcaaatctcaacctcctagtatatataacgcg
tcagcaacctctgtttttcataaacactgtgccattcatgtatttccatgggaccaggaa
tattttgatgtagagcccagctttactgtgacatatggaaagctagttaagctactttct
ccaaagcaacagcaaagtaaaacaaaacaaaatgtgttatcacctgaaaaagagaagcag
atgtcagagccactagatcaaaaaaaaattaggtcagatcataatgaagaagatgagaag
gcctgtgtgctacaagtagtctggaatggacttgaagaattgaacaatgccatcaaatat
accaaaaatgtagaagttctccatcttgggaaagtctggattccagatgacctgaggaag
agactaaatatagaaatgcatgccgtagtcaggataactccagtggaagttacccctaaa
attccaagatctctaaagttacaacctagagagaatttacctaaagacataagtgaagaa
gacataaaaactgtattttattcatggctacagcagtctactaccaccatgcttcctttg
gtaatatcagaggaagaatttattaagctggaaactaaagatggactgaaggaattttct
ctgagtatagttcattcttgggaaaaagaaaaagataaaaatatttttctgttgagtccc
aatttgctgcagaagactacaatacaagtccttctagatcctatggtaaaagaagaaaac
agtgaggaaattgactttattcttccttttttaaagctgagctctttgggaggagtgaat
tccttaggcgtatcctccttggagcacatcactcacagcctcctgggacgccctttgtct
cggcagctgatgtctcttgttgcaggacttaggaatggagctcttttactcacaggagga
aagggaagtggaaaatcaactttagccaaagcaatctgtaaagaagcatttgacaaactg
gatgcccatgtggagagagttgactgtaaagctttacgaggaaaaaggcttgaaaacata
caaaaaaccctagaggtggctttctcagaggcagtgtggatgcagccatctgttgtcctg
ctggatgaccttgacctcattgctggactgcctgctgtcccggaacatgagcacagtcct
gatgcggtgcagagccagcggcttgctcatgctttgaatgatatgataaaagagtttatc
tccatgggaagtttggttgcactgattgccacaagtcagtctcagcaatctctacatcct
ttacttgtttctgctcaaggagttcacatatttcagtgcgtccaacacattcagcctcct
aatcaggaacaaagatgtgaaattctgtgtaatgtaataaaaaataaattggactgtgat
ataaacaagttcaccgatcttgacctgcagcatgtagctaaagaaactggcgggtttgtg
gctagagattttacagtacttgtggatcgagccatacattctcgactctctcgtcagagt
atatccaccagagaaaaattagttttaacaacattggacttccaaaaggctctccgcgga
tttcttcctgcgtctttgcgaagtgtcaacctgcataaacctagagacctgggttgggac
aagattggtgggttacatgaagttaggcagatactcatggatactatccagttacctgcc
aagtatccagaattatttgcaaacttgcccatacgacaaagaacaggaatactgttgtat
ggtccgcctggaacaggaaaaaccttactagctggggtaattgcacgagagagtagaatg
aattttataagtgtcaaggggccagagttactcagcaaatacattggagcaagtgaacaa
gctgttcgggatatttttattagagcacaggctgcaaagccctgcattcttttctttgat
gaatttgaatccattgctcctcggcggggtcatgataatacaggagttacagaccgagta
gttaaccagttgctgactcagttggatggagtagaaggcttacagggtgtttatgtattg
gctgctactagtcgccctgacttgattgaccctgccctgcttaggcctggtcgactagat
aaatgtgtatactgtcctcctcctgatcaggtgtcacgtcttgaaattttaaatgtcctc
agtgactctctacctctggcagatgatgttgaccttcagcatgtagcatcagtaactgac
tcctttactggagctgatctgaaagctttactttacaatgcccaattggaggccttacat
ggaatgctgctctcgagtggactccaggatggaagttccagctctgatagtgacctaagt
ctgtcttcaatggtctttcttaaccatagcagtggctctgacgattcagctggagatgga
gaatgtggcttagatcagtcccttgtttctttagagatgtccgagatccttccagatgaa
tcaaaattcaatatgtaccggctctactttggaagctcttatgaatcagaacttggaaat
ggaacctcttctgatttgagctcacaatgtctctctgcaccaagctccatgactcaggat
ttgcctggagttcctgggaaagaccagttgttttcacagcctccagtgttaaggacagct
tcacaagagggttgccaagaacttacacaagaacaaagagatcaactgagggcagatatc
agtattatcaaaggcagataccggagccaaagtggagaggacgaatccatgaaccaacca
ggaccaatcaaaaccagactggctattagtcagtcacatttaatgactgcacttggtcac
acaagaccatccattagtgaagatgactggaagaattttgctgagctatatgaaagcttt
caaaatccaaagaggagaaaaaatcaaagtggaacaatgtttcgacctggacagaaagta
actttagcataa

DBGET integrated database retrieval system