KEGG   Homo sapiens (human): 5192Help
Entry
5192              CDS       T01001                                 

Gene name
PEX10, NALD, PBD6A, PBD6B, RNF69
Definition
(RefSeq) peroxisomal biogenesis factor 10
  KO
K13346  peroxin-10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04146  Peroxisome
Disease
H00177  Adrenoleukodystrophy, neonatal (NALD)
H00205  Peroxisome biogenesis disorder
H01342  Zellweger syndrome (ZS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    5192 (PEX10)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    5192 (PEX10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pex2_Pex12 zf-C3HC4_3 zf-RING_2 Prok-RING_4 zf-C3HC4_2 zf-C3HC4 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 zf-ANAPC11 zf-RING_4 DUF3290 zf-RING_6
Motif
Other DBs
NCBI-GeneID: 5192
NCBI-ProteinID: NP_002608
OMIM: 602859
HGNC: 8851
Ensembl: ENSG00000157911
Vega: OTTHUMG00000001637
Pharos: O60683(Tbio)
UniProt: O60683 A0A024R068
Position
1p36.32
AA seq 326 aa AA seqDB search
MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGL
TTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQAD
PDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVA
WFYIHGVFYHLAKRLTGITYLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFR
QRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAW
CSSKAECPLCREKFPPQKLIYLRHYR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggccccggccgccgccagccccccggaggtgatccgcgcggcgcagaaggacgagtac
taccgcggtgggctgcggagcgcggcgggcggcgccctgcacagcctggcgggtgcgagg
aagtggctggagtggaggaaggaggttgagctgctctcagatgtggcctactttggcctc
accacacttgcaggctaccagaccctgggggaggagtacgtcagcatcatccaggtggac
ccatcgcggatacatgtgccctcctcgctgcgccgtggcgtgctggtgacactgcatgcc
gtcctgccctacctgctggacaaggccctgctccccctggagcaggagctgcaggctgac
cccgacagtgggcgacccttgcaggggagcctggggccaggtgggcgtggctgctcaggg
gcgcggcgctggatgcgtcaccacacggccaccctgactgagcagcagaggagggcgctg
ctgcgggcggtcttcgtcctcagacagggcctcgcctgcctccagcggctacatgttgcc
tggttttacatccacggtgtcttctaccacctggccaagaggctcacggggatcacgtac
ctccgtgtccgcagcctgcccggagaggacctgagggcccgtgttagctacaggctgctg
ggggtcatctcactgctgcacctggtgctgtccatggggctgcagctgtacggtttcagg
cagcggcagcgagccaggaaggagtggaggctgcaccgcggcctgtctcaccgcagggcc
tccttggaggagagagccgtttccagaaaccccctgtgcaccctgtgcctggaggagcgc
aggcacccaacagccacgccctgcggccacctgttctgctgggagtgcatcaccgcgtgg
tgcagcagcaaggcggagtgtcccctctgccgggagaagttccctccccagaagctcatc
taccttcggcactaccgctga

DBGET integrated database retrieval system