KEGG   Homo sapiens (human): 5192Help
Entry
5192              CDS       T01001                                 

Gene name
PEX10, NALD, PBD6A, PBD6B, RNF69
Definition
(RefSeq) peroxisomal biogenesis factor 10
  KO
K13346  
peroxin-10
Organism
hsa  Homo sapiens (human)
Pathway
Peroxisome
Disease
H00177  
Adrenoleukodystrophy, neonatal (NALD)
H00205  
Peroxisome biogenesis disorder
H01342  
Zellweger syndrome (ZS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    5192 (PEX10)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Peripheral membrane proteins
    5192 (PEX10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p36.32
AA seq 326 aa AA seqDB search
MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGL
TTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQAD
PDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVA
WFYIHGVFYHLAKRLTGITYLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQLYGFR
QRQRARKEWRLHRGLSHRRASLEERAVSRNPLCTLCLEERRHPTATPCGHLFCWECITAW
CSSKAECPLCREKFPPQKLIYLRHYR
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggccccggccgccgccagccccccggaggtgatccgcgcggcgcagaaggacgagtac
taccgcggtgggctgcggagcgcggcgggcggcgccctgcacagcctggcgggtgcgagg
aagtggctggagtggaggaaggaggttgagctgctctcagatgtggcctactttggcctc
accacacttgcaggctaccagaccctgggggaggagtacgtcagcatcatccaggtggac
ccatcgcggatacatgtgccctcctcgctgcgccgtggcgtgctggtgacactgcatgcc
gtcctgccctacctgctggacaaggccctgctccccctggagcaggagctgcaggctgac
cccgacagtgggcgacccttgcaggggagcctggggccaggtgggcgtggctgctcaggg
gcgcggcgctggatgcgtcaccacacggccaccctgactgagcagcagaggagggcgctg
ctgcgggcggtcttcgtcctcagacagggcctcgcctgcctccagcggctacatgttgcc
tggttttacatccacggtgtcttctaccacctggccaagaggctcacggggatcacgtac
ctccgtgtccgcagcctgcccggagaggacctgagggcccgtgttagctacaggctgctg
ggggtcatctcactgctgcacctggtgctgtccatggggctgcagctgtacggtttcagg
cagcggcagcgagccaggaaggagtggaggctgcaccgcggcctgtctcaccgcagggcc
tccttggaggagagagccgtttccagaaaccccctgtgcaccctgtgcctggaggagcgc
aggcacccaacagccacgccctgcggccacctgttctgctgggagtgcatcaccgcgtgg
tgcagcagcaaggcggagtgtcccctctgccgggagaagttccctccccagaagctcatc
taccttcggcactaccgctga

DBGET integrated database retrieval system