KEGG   Homo sapiens (human): 5196Help
Entry
5196              CDS       T01001                                 

Gene name
PF4, CXCL4, PF-4, SCYB4
Definition
platelet factor 4
Orthology
K05407  
platelet factor 4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5196 (PF4)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    5196 (PF4)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  5196 (PF4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q12-q21
AA seq 101 aa AA seqDB search
MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEV
IKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgcagccgggttctgcgcctcacgccccgggctgctgttcctggggttgctg
ctcctgccacttgtggtcgccttcgccagcgctgaagctgaagaagatggggacctgcag
tgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagcctggaggtg
atcaaggccggaccccactgccccactgcccaactgatagccacgctgaagaatggaagg
aaaatttgcttggacctgcaagccccgctgtacaagaaaataattaagaaacttttggag
agttag

DBGET integrated database retrieval system