KEGG   Homo sapiens (human): 5197Help
Entry
5197              CDS       T01001                                 

Gene name
PF4V1, CXCL4L1, CXCL4V1, PF4-ALT, PF4A, SCYB4V1
Definition
platelet factor 4 variant 1
Orthology
K05407  
platelet factor 4
Organism
hsa  Homo sapiens (human)
Pathway
Cytokine-cytokine receptor interaction
Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    5197 (PF4V1)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    5197 (PF4V1)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Chemokines (General comment) Chemokine presentation, transcellular transport, signal transduction
  5197 (PF4V1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q12-q21
AA seq 104 aa AA seqDB search
MSSAARSRLTRATRQEMLFLALLLLPVVVAFARAEAEEDGDLQCLCVKTTSQVRPRHITS
LEVIKAGPHCPTAQLIATLKNGRKICLDLQALLYKKIIKEHLES
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atgagctccgcagccaggtcccgcctcacccgcgccacccgccaggagatgctgttcttg
gcgttgctgctcctgccagttgtggtcgccttcgccagagctgaagctgaagaagatggg
gacctgcagtgcctgtgtgtgaagaccacctcccaggtccgtcccaggcacatcaccagc
ctggaggtgatcaaggccggaccccactgccccactgcccaactcatagccacgctgaag
aatgggaggaaaatttgcttggatctgcaagccctgctgtacaagaaaatcattaaggaa
catttggagagttag

  All links  
No link information was found.   
DBGET integrated database retrieval system