KEGG   Homo sapiens (human): 52Help
Entry
52                CDS       T01001                                 

Gene name
ACP1, HAAP
Definition
acid phosphatase 1, soluble (EC:3.1.3.2 3.1.3.48)
Orthology
K14394  
low molecular weight phosphotyrosine protein phosphatase [EC:3.1.3.2 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Riboflavin metabolism
Adherens junction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    52 (ACP1)
 Cellular Processes
  Cell communication
   04520 Adherens junction
    52 (ACP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     52 (ACP1)
    3.1.3.48  protein-tyrosine-phosphatase
     52 (ACP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p25
AA seq 112 aa AA seqDB search
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQVPSLDLKLCVLCFSGSLTAVLFLTGTWAGPQTQEL
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacaggctaccaagtccgtgctgtttgtgtgtctgggtaacatttgtcgatca
cccattgcagaagcagttttcaggaaacttgtaaccgatcaaaacatctcagagaattgg
agggtagacagcgcggcaacttccgggtatgagatagggaacccccctgactaccgaggg
cagagctgcatgaagaggcacggcattcccatgagccacgttgcccggcaggtaccgtcc
ttggacttgaagttgtgtgttttgtgtttcagtgggtcattgacagcggtgctgtttctg
actggaacgtgggccggtccccagacccaagagctgtga

DBGET integrated database retrieval system