KEGG   Homo sapiens (human): 52Help
Entry
52                CDS       T01001                                 

Gene name
ACP1, HAAP
Definition
acid phosphatase 1, soluble (EC:3.1.3.2 3.1.3.48)
Orthology
K14394  
low molecular weight phosphotyrosine protein phosphatase [EC:3.1.3.2 3.1.3.48]
Organism
hsa  Homo sapiens (human)
Pathway
Riboflavin metabolism
Adherens junction
Class
Metabolism; Metabolism of cofactors and vitamins; Riboflavin metabolism [PATH:hsa00740]
Cellular Processes; Cell communication; Adherens junction [PATH:hsa04520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2p25
AA seq 112 aa AA seqDB search
MAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWRVDSAATSGYEIGNPPDYRG
QSCMKRHGIPMSHVARQVPSLDLKLCVLCFSGSLTAVLFLTGTWAGPQTQEL
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacaggctaccaagtccgtgctgtttgtgtgtctgggtaacatttgtcgatca
cccattgcagaagcagttttcaggaaacttgtaaccgatcaaaacatctcagagaattgg
agggtagacagcgcggcaacttccgggtatgagatagggaacccccctgactaccgaggg
cagagctgcatgaagaggcacggcattcccatgagccacgttgcccggcaggtaccgtcc
ttggacttgaagttgtgtgttttgtgtttcagtgggtcattgacagcggtgctgtttctg
actggaacgtgggccggtccccagacccaagagctgtga

DBGET integrated database retrieval system