KEGG   Homo sapiens (human): 5207Help
Entry
5207              CDS       T01001                                 

Gene name
PFKFB1, F6PK, HL2K, PFRX
Definition
(RefSeq) 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 (EC:2.7.1.105 3.1.3.46)
  KO
K19028  
6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 1 [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
Fructose and mannose metabolism
AMPK signaling pathway
Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5207 (PFKFB1)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    5207 (PFKFB1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    5207 (PFKFB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     5207 (PFKFB1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     5207 (PFKFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.21
AA seq 449 aa AA seqDB search
MSPEMGELTQTRLQKIWIPHSSGSSRLQRRRGSSIPQFTNSPTMVIMVGLPARGKTYIST
KLTRYLNWIGTPTKDNMEALQIRKQCALAALKDVHNYLSHEEGHVAVFDATNTTRERRSL
ILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECYEV
NYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTVYYLMNIHVTPRSIYLCRHGES
ELNIRGRIGGDSGLSVRGKQYAYALANFIQSQGISSLKVWTSHMKRTIQTAEALGVPYEQ
WKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMEL
ERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCKVESIYLNVE
AVNTHREKPENVDITREPEEALDTVPAHY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctccagagatgggagagctcacccaaaccaggttgcagaagatctggattccacac
agcagcggcagcagcaggctgcaacggagaaggggctcatccataccccagtttaccaat
tcccccacaatggtgatcatggtgggtttaccagctcgaggcaagacctatatctccaca
aagctcacacgatatctcaactggataggaacaccaactaaagacaacatggaagccctg
caaatcaggaagcagtgcgccctggcagccctgaaggatgttcacaactatctcagccat
gaggaaggtcatgttgcggtttttgatgccaccaacactaccagagaacgacggtcactg
atcctgcagtttgcaaaagaacatggttacaaggtgtttttcattgagtccatttgtaat
gaccctggcataattgcagaaaacatcaggcaagtgaaacttggcagccctgattatata
gactgtgaccgggaaaaggttctggaagactttctaaagagaattgagtgctatgaggtc
aactaccaacccttggatgaggaactggacagccacctgtcctacatcaagatcttcgac
gtgggcacacgctacatggtgaaccgagtgcaggatcacatccagagccgcacagtctac
tacctcatgaatatccatgtcacacctcgctccatctacctttgccgacatggcgagagt
gaactcaacatcagaggccgcatcggaggtgactctggcctctcagttcgcggcaagcag
tatgcctatgccctggccaacttcattcagtcccagggcatcagctccctgaaggtgtgg
accagtcacatgaagaggaccatccagacagctgaggccctgggtgtcccctatgagcag
tggaaggccctgaatgagattgatgcgggtgtctgtgaggagatgacctatgaagaaatc
caggaacattaccctgaagaatttgcactgcgagaccaagataaatatcgctaccgctat
cccaagggagagtcctatgaggatctggttcagcgtctggagccagtgataatggagcta
gaacgacaggagaatgtactggtgatctgccaccaggctgtcatgcggtgcctcctggcc
tatttcctggataaaagttcagatgagcttccatatctcaagtgccctctgcacacagtg
ctcaaactcactcctgtggcttatggctgcaaagtggaatccatctacctgaatgtggag
gccgtgaacacacaccgggagaagcctgagaatgtggacatcacccgggaacctgaggaa
gccctggatactgtcccagcccactactga

DBGET integrated database retrieval system