KEGG   Homo sapiens (human): 5207Help
Entry
5207              CDS       T01001                                 

Gene name
PFKFB1, F6PK, HL2K, PFRX
Definition
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 1 (EC:2.7.1.105 3.1.3.46)
Orthology
K01103  
6-phosphofructo-2-kinase / fructose-2,6-bisphosphatase [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
Fructose and mannose metabolism
HIF-1 signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5207 (PFKFB1)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    5207 (PFKFB1)
   04152 AMPK signaling pathway
    5207 (PFKFB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     5207 (PFKFB1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     5207 (PFKFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
Xp11.21
AA seq 449 aa AA seqDB search
MSPEMGELTQTRLQKIWIPHSSGSSRLQRRRGSSIPQFTNSPTMVIMVGLPARGKTYIST
KLTRYLNWIGTPTKDNMEALQIRKQCALAALKDVHNYLSHEEGHVAVFDATNTTRERRSL
ILQFAKEHGYKVFFIESICNDPGIIAENIRQVKLGSPDYIDCDREKVLEDFLKRIECYEV
NYQPLDEELDSHLSYIKIFDVGTRYMVNRVQDHIQSRTVYYLMNIHVTPRSIYLCRHGES
ELNIRGRIGGDSGLSVRGKQYAYALANFIQSQGISSLKVWTSHMKRTIQTAEALGVPYEQ
WKALNEIDAGVCEEMTYEEIQEHYPEEFALRDQDKYRYRYPKGESYEDLVQRLEPVIMEL
ERQENVLVICHQAVMRCLLAYFLDKSSDELPYLKCPLHTVLKLTPVAYGCKVESIYLNVE
AVNTHREKPENVDITREPEEALDTVPAHY
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgtctccagagatgggagagctcacccaaaccaggttgcagaagatctggattccacac
agcagcggcagcagcaggctgcaacggagaaggggctcatccataccccagtttaccaat
tcccccacaatggtgatcatggtgggtttaccagctcgaggcaagacctatatctccaca
aagctcacacgatatctcaactggataggaacaccaactaaagacaacatggaagccctg
caaatcaggaagcagtgcgccctggcagccctgaaggatgttcacaactatctcagccat
gaggaaggtcatgttgcggtttttgatgccaccaacactaccagagaacgacggtcactg
atcctgcagtttgcaaaagaacatggttacaaggtgtttttcattgagtccatttgtaat
gaccctggcataattgcagaaaacatcaggcaagtgaaacttggcagccctgattatata
gactgtgaccgggaaaaggttctggaagactttctaaagagaattgagtgctatgaggtc
aactaccaacccttggatgaggaactggacagccacctgtcctacatcaagatcttcgac
gtgggcacacgctacatggtgaaccgagtgcaggatcacatccagagccgcacagtctac
tacctcatgaatatccatgtcacacctcgctccatctacctttgccgacatggcgagagt
gaactcaacatcagaggccgcatcggaggtgactctggcctctcagttcgcggcaagcag
tatgcctatgccctggccaacttcattcagtcccagggcatcagctccctgaaggtgtgg
accagtcacatgaagaggaccatccagacagctgaggccctgggtgtcccctatgagcag
tggaaggccctgaatgagattgatgcgggtgtctgtgaggagatgacctatgaagaaatc
caggaacattaccctgaagaatttgcactgcgagaccaagataaatatcgctaccgctat
cccaagggagagtcctatgaggatctggttcagcgtctggagccagtgataatggagcta
gaacgacaggagaatgtactggtgatctgccaccaggctgtcatgcggtgcctcctggcc
tatttcctggataaaagttcagatgagcttccatatctcaagtgccctctgcacacagtg
ctcaaactcactcctgtggcttatggctgcaaagtggaatccatctacctgaatgtggag
gccgtgaacacacaccgggagaagcctgagaatgtggacatcacccgggaacctgaggaa
gccctggatactgtcccagcccactactga

DBGET integrated database retrieval system