KEGG   Homo sapiens (human): 5208Help
Entry
5208              CDS       T01001                                 

Gene name
PFKFB2, PFK-2/FBPase-2
Definition
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 (EC:2.7.1.105 3.1.3.46)
Orthology
K19029  
6-phosphofructo-2-kinase / fructose-2,6-biphosphatase 2 [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
Fructose and mannose metabolism
AMPK signaling pathway
Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    5208 (PFKFB2)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    5208 (PFKFB2)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    5208 (PFKFB2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.105  6-phosphofructo-2-kinase
     5208 (PFKFB2)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.46  fructose-2,6-bisphosphate 2-phosphatase
     5208 (PFKFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q31
AA seq 471 aa AA seqDB search
MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTR
YLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEE
NGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPE
RNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVY
YLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVW
TSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRY
PGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTI
FKLTPVAYGCKVETIKLNVEAVNTHRDKPTAAETTLAVRRRPSAASLMLPC
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtctggggcatcttcctcagaacagaacaacaacagctatgaaaccaaaaccccaaat
cttcgaatgtcagagaagaaatgttcatgggcctcctacatgaccaactccccgactctg
atcgttatgattggtttgccagcccggggtaaaacctacgtgtccaagaaactaacacgc
tacctcaactggattggagtccccaccaaagtgtttaatcttggggtgtatcggcgtgaa
gcagtcaagtcctataagtcctacgacttctttcggcatgacaatgaggaggccatgaag
atccgcaaacagtgtgctctggtggcgctggaagatgttaaggcgtatctcactgaggag
aatggtcagattgcggtgtttgatgccaccaatacaacccgggagaggagggacatgatt
ttgaactttgctgaacagaattccttcaaggtattctttgtggaatccgtctgtgatgat
cctgatgtcattgctgccaatattctggaggttaaggtatcaagccctgactatcctgaa
aggaacagagagaacgtgatggaggacttcctgaagagaattgaatgctacaaagttacc
taccgacctcttgacccagacaactatgacaaggatctttctttcatcaaggtgataaac
gtgggccagcgatttttagtcaacagagtccaggactacatccagagcaagatagtctac
tacctcatgaatatccacgtccagcctcgcaccatttacctttgccggcatggagaaagc
gagttcaatctcttggggaagattgggggtgactctggcctctcggtgcggggaaagcag
tttgcccaagctctaaggaaatttctggaggaacaggaaataacagacctcaaagtgtgg
acaagccagttgaagaggaccatacagactgctgaatctctcggggtgccctatgagcag
tggaagattctgaatgagattgatgctggtgtgtgtgaagagatgacctatgcagagatt
gagaaacggtacccagaagagtttgcacttcgagatcaagagaagtatctgtatcgatat
cctggtggggagtcataccaggacctggtgcagcggctggagcctgtcatcatggagctg
gaacgtcagggcaatgtcctcgtcatctcccaccaggctgtcatgcgctgcctcctggcc
tacttcttggataagggcgcagatgagctaccatacttgagatgccctctccataccatc
ttcaaacttactcctgtggcctatgggtgcaaagtggaaacaattaaacttaacgtggag
gctgtgaacacgcaccgtgacaagccaactgcagcagagaccacactggctgtgcgcaga
cgcccctccgcagcgtccctcatgttgccttgctaa

DBGET integrated database retrieval system