KEGG   Homo sapiens (human): 521Help
Entry
521               CDS       T01001                                 

Gene name
ATP5I, ATP5K
Definition
ATP synthase, H+ transporting, mitochondrial Fo complex, subunit E (EC:3.6.1.14)
Orthology
K02129  
F-type H+-transporting ATPase subunit e
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Module
F-type ATPase, eukaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
4p16.3
AA seq 69 aa AA seqDB search
MVPPVQVSPLIKLGRYSALFLGVAYGATRYNYLKPRAEEERRIAAEEKKKQDELKRIARE
LAEDDSILK
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggtgccaccggtgcaggtctctccgctcatcaagctcggccgctactccgccctgttc
ctcggtgtggcctacggagccacgcgctacaattacctaaaacctcgggcagaagaggag
aggaggatagcagcagaagagaagaagaagcaggatgaactgaaacggattgccagagaa
ttggcagaagatgacagcatattaaagtga

DBGET integrated database retrieval system