KEGG   Homo sapiens (human): 5210Help
Entry
5210              CDS       T01001                                 

Gene name
PFKFB4
Definition
6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 4 (EC:2.7.1.105 3.1.3.46)
Orthology
K01103  
6-phosphofructo-2-kinase / fructose-2,6-bisphosphatase [EC:2.7.1.105 3.1.3.46]
Organism
hsa  Homo sapiens (human)
Pathway
Fructose and mannose metabolism
HIF-1 signaling pathway
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hsa00051]
Environmental Information Processing; Signal transduction; HIF-1 signaling pathway [PATH:hsa04066]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
3p22-p21
AA seq 469 aa AA seqDB search
MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPARGKTYISKKLT
RYLNWIGVPTREFNVGQYRRDVVKTYKSFEFFLPDNEEGLKIRKQCALAALRDVRRFLSE
EGGHVAVFDATNTTRERRATIFNFGEQNGYKTFFVESICVDPEVIAANIVQVKLGSPDYV
NRDSDEATEDFMRRIECYENSYESLDEDLDRDLSYIKIMDVGQSYVVNRVADHIQSRIVY
YLMNIHVTPRSIYLCRHGESELNLKGRIGGDPGLSPRGREFAKSLAQFISDQNIKDLKVW
TSQMKRTIQTAEALGVPYEQWKVLNEIDAGVCEEMTYEEIQDNYPLEFALRDQDKYRYRY
PKGESYEDLVQRLEPVIMELERQENVLVICHQAVMRCLLAYFLDKAAEQLPYLKCPLHTV
LKLTPVAYGCKVESIFLNVAAVNTHRDRPQNVDISRPPEEALVTVPAHQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccccacgggaattgacacagaaccccctgaagaagatctggatgccatacagc
aatgggcggcccgctctgcacgcttgccagcgcggtgtgtgcatgaccaactgcccaact
ctcattgtcatggtgggcctgcccgccaggggcaagacctacatctccaagaagctgact
cgatacctgaactggattggtgtgcccactcgggagttcaatgttggccagtatcgccgg
gacgtggtcaagacctacaaatcttttgaattttttctccccgacaatgaagagggcctg
aaaatcaggaagcagtgtgccctggcagccctccgtgacgtccggcggttccttagtgag
gaggggggacatgtggcggtttttgatgccacaaacaccacccgagaacggagagcgacc
atctttaattttggagaacagaatggctacaagaccttttttgtcgagtccatctgtgtg
gatcctgaggtcatagctgccaacatcgtgcaagtgaaactgggcagccctgactatgtc
aaccgcgacagtgatgaggctacggaggacttcatgaggcgcattgagtgctatgagaac
tcctacgagtcgctagatgaggacctggatagggacctgtcctatatcaagatcatggat
gtgggccagagctacgtggtgaaccgtgtggctgaccacatccagagccgcatcgtatat
tacctcatgaacatccacgtgaccccccgctccatctacctctgccggcacggggagagc
gagctcaacctcaagggccggattggcggggacccaggactgtcccctcggggcagggag
tttgccaagagtctagcccagttcatcagtgaccaaaatatcaaggatctgaaggtctgg
acaagccagatgaagaggacaatccagacggctgaggcactgggtgtgccctatgaacag
tggaaggtcctcaacgagatcgatgcgggcgtctgtgaggaaatgacctacgaggaaatt
caggataattatccactggagttcgccctgcgggaccaggacaagtaccggtaccggtac
cctaaaggggagtcctacgaggacctggtccagagactggagcctgtcatcatggagctg
gagaggcaagagaatgtgctggtcatctgccaccaggctgtgatgcgctgcctgctggcc
tacttcctcgacaaggcagcagaacagctgccctacctcaagtgtccgctgcacacagtc
ctgaagctgactcctgtggcatatggttgtaaagtggagtccatattcctgaacgtggct
gctgtgaacacgcaccgggacaggcctcagaacgtggacatctcaagacctccagaggaa
gcccttgtcacggtgcctgctcaccagtga

DBGET integrated database retrieval system