KEGG   Homo sapiens (human): 5211Help
Entry
5211              CDS       T01001                                 

Gene name
PFKL, PFK-B
Definition
phosphofructokinase, liver (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
HIF-1 signaling pathway
AMPK signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5211 (PFKL)
   01230 Biosynthesis of amino acids
    5211 (PFKL)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5211 (PFKL)
   00030 Pentose phosphate pathway
    5211 (PFKL)
   00051 Fructose and mannose metabolism
    5211 (PFKL)
   00052 Galactose metabolism
    5211 (PFKL)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    5211 (PFKL)
   04152 AMPK signaling pathway
    5211 (PFKL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     5211 (PFKL)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5211 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 830 aa AA seqDB search
MRSMCNQGRGRESSRGGLHVQGSCRGLSRSPQQETGFAKAPAGTDCFFHCSPGSRGQGDR
KEEVTSEPGGTSIMSRLGGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANW
LSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRS
EWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVID
AITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGET
RSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDR
ILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLMECVQMTKEVQKAMDDKRFDEA
TQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISHGH
TVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESIVENIRIYGIH
ALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAME
SCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKVNVEH
MTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPF
DRNYGTKLGVKAMLWLSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFSPVTELKKDTD
FEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDKGF
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcatgtgtaaccagggtagaggtcgagagtcctctcgtgggggtctccatgtt
caagggagctgccgaggcttgagcaggagcccccagcaggaaactggctttgccaaggcc
cccgctgggacagactgtttctttcactgcagtcctgggagccgagggcaaggggacagg
aaagaggaagtgacctcagagcctggtggcaccagcatcatgtccaggctggggggcatg
aacgctgctgtccgggctgtgacgcgcatgggcatttatgtgggtgccaaagtcttcctc
atctacgagggctatgagggcctcgtggagggaggtgagaacatcaagcaggccaactgg
ctgagcgtctccaacatcatccagctgggcggcactatcattggcagcgctcgctgcaag
gcctttaccaccagggaggggcgccgggcagcggcctacaacctggtccagcacggcatc
accaacctgtgcgtcatcggcggggatggcagcctcacaggtgccaacatcttccgcagc
gagtggggcagcctgctggaggagctggtggcggaaggtaagatctcagagactacagcc
cggacctactcgcacctgaacatcgcgggcctagtgggctccatcgataacgacttctgc
ggcaccgacatgaccatcggcacggactcggccctccaccgcatcatggaggtcatcgat
gccatcaccaccactgcccagagccaccagaggaccttcgtgctggaagtgatgggccgg
cactgcgggtacctggcgctggtatctgcactggcctcaggggccgactggctgttcatc
cccgaggctccacccgaggacggctgggagaacttcatgtgtgagaggctgggtgagact
cggagccgtgggtcccgactgaacatcatcatcatcgctgagggtgccattgaccgcaac
gggaagcccatctcgtccagctacgtgaaggacctggtggttcagaggctgggcttcgac
acccgtgtaactgtgctgggccacgtgcagcggggagggacgccctctgccttcgaccgg
atcctgagcagcaagatgggcatggaggcggtgatggcgctgctggaagccacgcctgac
acgccggcctgcgtggtcaccctctcggggaaccagtcagtgcggctgcccctcatggag
tgcgtgcagatgaccaaggaagtgcagaaagccatggatgacaagaggtttgacgaggcc
acccagctccgtggtgggagcttcgagaacaactggaacatttacaagctcctcgcccac
cagaagccccccaaggagaagtctaacttctccctggccatcctgaatgtgggggccccg
gcggctggcatgaatgcggccgtgcgctcggcggtgcggaccggcatctcccatggacac
acagtatacgtggtgcacgatggcttcgaaggcctagccaagggtcaggtgcaagaagta
ggctggcacgacgtggccggctggttggggcgtggtggctccatgctggggaccaagagg
accctgcccaagggccagctggagtccattgtggagaacatccgcatctatggtattcac
gccctgctggtggtcggtgggtttgaggcctatgaaggggtgctgcagctggtggaggct
cgcgggcgctacgaggagctctgcatcgtcatgtgtgtcatcccagccaccatcagcaac
aacgtccctggcaccgacttcagcctgggctccgacactgctgtaaatgccgccatggag
agctgtgaccgcatcaaacagtctgcctcggggaccaagcgccgtgtgttcatcgtggag
accatggggggttactgtggctacctggccaccgtgactggcattgctgtgggggccgac
gccgcctacgtcttcgaggaccctttcaacatccacgacttaaaggtcaacgtggagcac
atgacggagaagatgaagacagacattcagaggggcctggtgctgcggaacgagaagtgc
catgactactacaccacggagttcctgtacaacctgtactcatcagagggcaagggcgtc
ttcgactgcaggaccaatgtcctgggccacctgcagcagggtggcgctccaacccccttt
gaccggaactatgggaccaagctgggggtgaaggccatgctgtggttgtcggagaagctg
cgcgaggtttaccgcaagggacgggtgttcgccaatgccccagactcggcctgcgtgatc
ggcctgaagaagaaggcggtggccttcagccccgtcactgagctcaagaaagacactgat
ttcgagcaccgcatgccacgggagcagtggtggctgagcctgcggctcatgctgaagatg
ctggcacaataccgcatcagtatggccgcctacgtgtcaggggagctggagcacgtgacc
cgccgcaccctgagcatggacaagggcttctga

DBGET integrated database retrieval system