KEGG   Homo sapiens (human): 5211Help
Entry
5211              CDS       T01001                                 

Gene name
PFKL, ATP-PFK, PFK-B, PFK-L
Definition
phosphofructokinase, liver (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
HIF-1 signaling pathway
AMPK signaling pathway
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5211 (PFKL)
   01230 Biosynthesis of amino acids
    5211 (PFKL)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5211 (PFKL)
   00030 Pentose phosphate pathway
    5211 (PFKL)
   00051 Fructose and mannose metabolism
    5211 (PFKL)
   00052 Galactose metabolism
    5211 (PFKL)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    5211 (PFKL)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    5211 (PFKL)
   04152 AMPK signaling pathway
    5211 (PFKL)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    5211 (PFKL)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    5211 (PFKL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     5211 (PFKL)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5211 (PFKL)
Messenger RNA biogenesis [BR:hsa03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     5211 (PFKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
21q22.3
AA seq 830 aa AA seqDB search
MRSMCNQGRGRESSRGGLHVQGSCRGLSRSPQQETGFAKAPAGTDCFFHCSPGSRGQGDR
KEEVTSEPGGTSIMSRLGGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANW
LSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRS
EWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVID
AITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGET
RSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQRGGTPSAFDR
ILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLMECVQMTKEVQKAMDDKRFDEA
TQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRSAVRTGISHGH
TVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESIVENIRIYGIH
ALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAME
SCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKVNVEH
MTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPF
DRNYGTKLGVKAMLWLSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFSPVTELKKDTD
FEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDKGF
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgagaagcatgtgtaaccagggtagaggtcgagagtcctctcgtgggggtctccatgtt
caagggagctgccgaggcttgagcaggagcccccagcaggaaactggctttgccaaggcc
cccgctgggacagactgtttctttcactgcagtcctgggagccgagggcaaggggacagg
aaagaggaagtgacctcagagcctggtggcaccagcatcatgtccaggctggggggcatg
aacgctgctgtccgggctgtgacgcgcatgggcatttatgtgggtgccaaagtcttcctc
atctacgagggctatgagggcctcgtggagggaggtgagaacatcaagcaggccaactgg
ctgagcgtctccaacatcatccagctgggcggcactatcattggcagcgctcgctgcaag
gcctttaccaccagggaggggcgccgggcagcggcctacaacctggtccagcacggcatc
accaacctgtgcgtcatcggcggggatggcagcctcacaggtgccaacatcttccgcagc
gagtggggcagcctgctggaggagctggtggcggaaggtaagatctcagagactacagcc
cggacctactcgcacctgaacatcgcgggcctagtgggctccatcgataacgacttctgc
ggcaccgacatgaccatcggcacggactcggccctccaccgcatcatggaggtcatcgat
gccatcaccaccactgcccagagccaccagaggaccttcgtgctggaagtgatgggccgg
cactgcgggtacctggcgctggtatctgcactggcctcaggggccgactggctgttcatc
cccgaggctccacccgaggacggctgggagaacttcatgtgtgagaggctgggtgagact
cggagccgtgggtcccgactgaacatcatcatcatcgctgagggtgccattgaccgcaac
gggaagcccatctcgtccagctacgtgaaggacctggtggttcagaggctgggcttcgac
acccgtgtaactgtgctgggccacgtgcagcggggagggacgccctctgccttcgaccgg
atcctgagcagcaagatgggcatggaggcggtgatggcgctgctggaagccacgcctgac
acgccggcctgcgtggtcaccctctcggggaaccagtcagtgcggctgcccctcatggag
tgcgtgcagatgaccaaggaagtgcagaaagccatggatgacaagaggtttgacgaggcc
acccagctccgtggtgggagcttcgagaacaactggaacatttacaagctcctcgcccac
cagaagccccccaaggagaagtctaacttctccctggccatcctgaatgtgggggccccg
gcggctggcatgaatgcggccgtgcgctcggcggtgcggaccggcatctcccatggacac
acagtatacgtggtgcacgatggcttcgaaggcctagccaagggtcaggtgcaagaagta
ggctggcacgacgtggccggctggttggggcgtggtggctccatgctggggaccaagagg
accctgcccaagggccagctggagtccattgtggagaacatccgcatctatggtattcac
gccctgctggtggtcggtgggtttgaggcctatgaaggggtgctgcagctggtggaggct
cgcgggcgctacgaggagctctgcatcgtcatgtgtgtcatcccagccaccatcagcaac
aacgtccctggcaccgacttcagcctgggctccgacactgctgtaaatgccgccatggag
agctgtgaccgcatcaaacagtctgcctcggggaccaagcgccgtgtgttcatcgtggag
accatggggggttactgtggctacctggccaccgtgactggcattgctgtgggggccgac
gccgcctacgtcttcgaggaccctttcaacatccacgacttaaaggtcaacgtggagcac
atgacggagaagatgaagacagacattcagaggggcctggtgctgcggaacgagaagtgc
catgactactacaccacggagttcctgtacaacctgtactcatcagagggcaagggcgtc
ttcgactgcaggaccaatgtcctgggccacctgcagcagggtggcgctccaacccccttt
gaccggaactatgggaccaagctgggggtgaaggccatgctgtggttgtcggagaagctg
cgcgaggtttaccgcaagggacgggtgttcgccaatgccccagactcggcctgcgtgatc
ggcctgaagaagaaggcggtggccttcagccccgtcactgagctcaagaaagacactgat
ttcgagcaccgcatgccacgggagcagtggtggctgagcctgcggctcatgctgaagatg
ctggcacaataccgcatcagtatggccgcctacgtgtcaggggagctggagcacgtgacc
cgccgcaccctgagcatggacaagggcttctga

DBGET integrated database retrieval system