KEGG   Homo sapiens (human): 5214Help
Entry
5214              CDS       T01001                                 

Gene name
PFKP, PFK-C, PFKF
Definition
phosphofructokinase, platelet (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Thyroid hormone signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hsa00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:hsa00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:hsa00052]
Organismal Systems; Endocrine system; Thyroid hormone signaling pathway [PATH:hsa04919]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p15.3-p15.2
AA seq 776 aa AA seqDB search
MCGYERCRPCRGAHGYLRGGQGVLHLRGLPGHGGRRLKHRRGRLGECLQHPASGAVRGDW
REKPGCWSHRFPCPGRHALVGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIGGD
GSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTD
SALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGW
EEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTRVTILGHV
QRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMECVQMTQDVQ
KAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGAPAAGMNAA
VRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKRVLPGKYL
EEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSNNVPGSDF
SIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEE
PFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGVFDCRKNV
LGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSICVLGISKRNVI
FQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQPWSV
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggtatgaacgctgccgtccgtgccgtggtgcgcatgggtatctacgtgggggc
caaggtgtacttcatctacgagggctaccagggcatggtggacggaggctcaaacatcgc
agaggccgactgggagagtgtctccagcatcctgcaagtggtgctgtaaggggtgactgg
agggagaagcctggctgctggtcacaccgcttcccttgtcctggccggcatgctctggtg
ggcgggacgatcattggcagtgcgcggtgccaggccttccgcacgcgggaaggccgcctg
aaggctgcttgcaacctgctgcagcgcggcatcaccaacctgtgtgtgatcggcggggac
gggagcctcaccggggccaacctcttccggaaggagtggagtgggctgctggaggagctg
gccaggaacggccagatcgataaggaggccgtgcagaagtacgcctacctcaacgtggtg
ggcatggtgggctccatcgacaatgatttctgcggcaccgacatgaccatcggcacggac
tccgccctgcacaggatcatcgaggtcgtcgacgccatcatgaccacggcccagagccac
cagaggaccttcgttctggaggtgatgggacgacactgtgggtacctggccctggtgagt
gccttggcctgcggtgcggactgggtgttccttccagaatctccaccagaggaaggctgg
gaggagcagatgtgtgtcaaactctcggagaaccgtgcccggaaaaaaaggctgaatatt
attattgtggctgaaggagcaattgatacccaaaataaacccatcacctctgagaaaatc
aaagagcttgtcgtcacgcagctgggctatgacacacgtgtgaccatcctcgggcacgtg
cagagaggagggaccccttcggcattcgacaggatcttggccagccgcatgggagtggag
gcagtcatcgccttgctagaggccaccccggacaccccagcttgcgtcgtgtcactgaac
gggaaccacgccgtgcgcctgccgctgatggagtgcgtgcagatgactcaggatgtgcag
aaggcgatggacgagaggagatttcaagatgcggttcgactccgagggaggagctttgcg
ggcaacctgaacacctacaagcgacttgccatcaagctgccggatgatcagatcccaaag
accaattgcaacgtagctgtcatcaacgtgggggcacccgcggctgggatgaacgcagcc
gtacgctcagctgtgcgcgtgggcattgccgacggccacaggatgctcgccatctatgat
ggctttgacggcttcgccaagggccagatcaaagaaatcggctggacagatgtcgggggc
tggaccggccaaggaggctccattcttgggacaaaacgcgttctcccggggaagtacttg
gaagagatcgccacacagatgcgcacgcacagcatcaacgcgctgctgatcatcggtgga
ttcgaggcctacctgggactcctggagctgtcagccgcccgggagaagcacgaggagttc
tgtgtccccatggtcatggttcccgctactgtgtccaacaatgtgccgggttccgatttc
agcatcggggcagacaccgccctgaacactatcaccgacacctgcgaccgcatcaagcag
tccgccagcggaaccaagcggcgcgtgttcatcatcgagaccatgggcggctactgtggc
tacctggccaacatgggggggctcgcggccggagctgatgccgcatacattttcgaagag
cccttcgacatcagggatctgcagtccaacgtggagcacctgacggagaaaatgaagacc
accatccagagaggccttgtgctcagaaatgagagctgcagtgaaaactacaccaccgac
ttcatttaccagctgtattcagaagagggcaaaggcgtgtttgactgcaggaagaacgtg
ctgggtcacatgcagcagggtggggcaccctctccatttgatagaaactttggaaccaaa
atctctgccagagctatggagtggatcactgcaaaactcaaggaggcccggggcagagga
aaaaaatttaccaccgatgattccatttgtgtgctgggaataagcaaaagaaacgttatt
tttcaacctgtggcagagctgaagaagcaaacggattttgagcacaggattcccaaagaa
cagtggtggctcaagctacggcccctcatgaaaatcctggccaagtacaaggccagctat
gacgtgtcggactcaggccagctggaacatgtgcagccctggagtgtctga

DBGET integrated database retrieval system