KEGG   Homo sapiens (human): 5214Help
Entry
5214              CDS       T01001                                 

Gene name
PFKP, ATP-PFK, PFK-C, PFK-P, PFKF
Definition
phosphofructokinase, platelet (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
AMPK signaling pathway
Thyroid hormone signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5214 (PFKP)
   01230 Biosynthesis of amino acids
    5214 (PFKP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5214 (PFKP)
   00030 Pentose phosphate pathway
    5214 (PFKP)
   00051 Fructose and mannose metabolism
    5214 (PFKP)
   00052 Galactose metabolism
    5214 (PFKP)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    5214 (PFKP)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    5214 (PFKP)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    5214 (PFKP)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    5214 (PFKP)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     5214 (PFKP)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5214 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
10p15.3-p15.2
AA seq 776 aa AA seqDB search
MCGYERCRPCRGAHGYLRGGQGVLHLRGLPGHGGRRLKHRRGRLGECLQHPASGAVRGDW
REKPGCWSHRFPCPGRHALVGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIGGD
GSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTD
SALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGW
EEQMCVKLSENRARKKRLNIIIVAEGAIDTQNKPITSEKIKELVVTQLGYDTRVTILGHV
QRGGTPSAFDRILASRMGVEAVIALLEATPDTPACVVSLNGNHAVRLPLMECVQMTQDVQ
KAMDERRFQDAVRLRGRSFAGNLNTYKRLAIKLPDDQIPKTNCNVAVINVGAPAAGMNAA
VRSAVRVGIADGHRMLAIYDGFDGFAKGQIKEIGWTDVGGWTGQGGSILGTKRVLPGKYL
EEIATQMRTHSINALLIIGGFEAYLGLLELSAAREKHEEFCVPMVMVPATVSNNVPGSDF
SIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEE
PFDIRDLQSNVEHLTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGVFDCRKNV
LGHMQQGGAPSPFDRNFGTKISARAMEWITAKLKEARGRGKKFTTDDSICVLGISKRNVI
FQPVAELKKQTDFEHRIPKEQWWLKLRPLMKILAKYKASYDVSDSGQLEHVQPWSV
NT seq 2331 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggtatgaacgctgccgtccgtgccgtggtgcgcatgggtatctacgtgggggc
caaggtgtacttcatctacgagggctaccagggcatggtggacggaggctcaaacatcgc
agaggccgactgggagagtgtctccagcatcctgcaagtggtgctgtaaggggtgactgg
agggagaagcctggctgctggtcacaccgcttcccttgtcctggccggcatgctctggtg
ggcgggacgatcattggcagtgcgcggtgccaggccttccgcacgcgggaaggccgcctg
aaggctgcttgcaacctgctgcagcgcggcatcaccaacctgtgtgtgatcggcggggac
gggagcctcaccggggccaacctcttccggaaggagtggagtgggctgctggaggagctg
gccaggaacggccagatcgataaggaggccgtgcagaagtacgcctacctcaacgtggtg
ggcatggtgggctccatcgacaatgatttctgcggcaccgacatgaccatcggcacggac
tccgccctgcacaggatcatcgaggtcgtcgacgccatcatgaccacggcccagagccac
cagaggaccttcgttctggaggtgatgggacgacactgtgggtacctggccctggtgagt
gccttggcctgcggtgcggactgggtgttccttccagaatctccaccagaggaaggctgg
gaggagcagatgtgtgtcaaactctcggagaaccgtgcccggaaaaaaaggctgaatatt
attattgtggctgaaggagcaattgatacccaaaataaacccatcacctctgagaaaatc
aaagagcttgtcgtcacgcagctgggctatgacacacgtgtgaccatcctcgggcacgtg
cagagaggagggaccccttcggcattcgacaggatcttggccagccgcatgggagtggag
gcagtcatcgccttgctagaggccaccccggacaccccagcttgcgtcgtgtcactgaac
gggaaccacgccgtgcgcctgccgctgatggagtgcgtgcagatgactcaggatgtgcag
aaggcgatggacgagaggagatttcaagatgcggttcgactccgagggaggagctttgcg
ggcaacctgaacacctacaagcgacttgccatcaagctgccggatgatcagatcccaaag
accaattgcaacgtagctgtcatcaacgtgggggcacccgcggctgggatgaacgcagcc
gtacgctcagctgtgcgcgtgggcattgccgacggccacaggatgctcgccatctatgat
ggctttgacggcttcgccaagggccagatcaaagaaatcggctggacagatgtcgggggc
tggaccggccaaggaggctccattcttgggacaaaacgcgttctcccggggaagtacttg
gaagagatcgccacacagatgcgcacgcacagcatcaacgcgctgctgatcatcggtgga
ttcgaggcctacctgggactcctggagctgtcagccgcccgggagaagcacgaggagttc
tgtgtccccatggtcatggttcccgctactgtgtccaacaatgtgccgggttccgatttc
agcatcggggcagacaccgccctgaacactatcaccgacacctgcgaccgcatcaagcag
tccgccagcggaaccaagcggcgcgtgttcatcatcgagaccatgggcggctactgtggc
tacctggccaacatgggggggctcgcggccggagctgatgccgcatacattttcgaagag
cccttcgacatcagggatctgcagtccaacgtggagcacctgacggagaaaatgaagacc
accatccagagaggccttgtgctcagaaatgagagctgcagtgaaaactacaccaccgac
ttcatttaccagctgtattcagaagagggcaaaggcgtgtttgactgcaggaagaacgtg
ctgggtcacatgcagcagggtggggcaccctctccatttgatagaaactttggaaccaaa
atctctgccagagctatggagtggatcactgcaaaactcaaggaggcccggggcagagga
aaaaaatttaccaccgatgattccatttgtgtgctgggaataagcaaaagaaacgttatt
tttcaacctgtggcagagctgaagaagcaaacggattttgagcacaggattcccaaagaa
cagtggtggctcaagctacggcccctcatgaaaatcctggccaagtacaaggccagctat
gacgtgtcggactcaggccagctggaacatgtgcagccctggagtgtctga

DBGET integrated database retrieval system