KEGG   Homo sapiens (human): 5217Help
Entry
5217              CDS       T01001                                 

Gene name
PFN2, D3S1319E, PFL
Definition
profilin 2
Orthology
K05759  
profilin
Organism
hsa  Homo sapiens (human)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Shigellosis
Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    5217 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5217 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    5217 (PFN2)
   05131 Shigellosis
    5217 (PFN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5217 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
3q25.1
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH
GGTLNKKAYELALYLRRSDV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt
cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc
gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat
gtggctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac
ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg
taa

DBGET integrated database retrieval system