KEGG   Homo sapiens (human): 5218Help
Entry
5218              CDS       T01001                                 

Gene name
CDK14, PFTAIRE1, PFTK1
Definition
cyclin-dependent kinase 14 (EC:2.7.11.22)
Orthology
K08821  
cyclin-dependent kinase 14 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    5218 (CDK14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     5218 (CDK14)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CMGC group
  CDK family
   5218 (CDK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21-q22
AA seq 469 aa AA seqDB search
MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIK
PLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSS
PSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIR
EASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQL
LRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPP
DVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGV
HSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFS
DLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgacctcattgagccgcagccggccgagaagatcggcaagatgaagaagttgcgg
agaactttgtcggagagtttcagtcgcattgctttgaagaaagatgacaccacctttgat
gagatatgtgtcacaaagatgtctacacggaactgccagggaatggactcagtgatcaaa
cccctggacacaattcctgaggataaaaaagtcagagttcagaggacacagagcactttt
gacccatttgagaaaccagctaatcaagtaaagagggtgcattctgagaacaatgcttgc
attaactttaagacctcctccactggcaaagagtcacctaaagttaggcggcactccagc
cccagctcgccaacaagtcccaaatttggaaaagctgactcatatgaaaagctggaaaaa
ctaggggaaggatcttatgctacagtatacaaagggaaaagcaaggtaaatgggaagttg
gtagctctgaaggtgatcaggctgcaggaagaagaagggacacctttcacagctatcagg
gaagcttctcttttaaaaggactaaaacatgctaacatagtgctacttcatgacatcatc
cataccaaggagacgctgacacttgtgtttgaatatgtgcacactgatttatgtcagtac
atggacaagcaccctggggggctgcatccagataatgtgaagttgtttttatttcagttg
ctgcgaggtctgtcttacatccaccagcgttatattttgcacagagacctgaaaccacag
aaccttctgatcagtgacacgggggagttaaagctggcagatttcggtcttgcaagagca
aaatccgtccctagccacacatactccaacgaagtggttaccttgtggtacagacctcca
gatgtccttctaggctcaacagaatattccacctgccttgacatgtggggagtaggttgc
atctttgttgaaatgatccaaggagttgctgcttttccaggaatgaaagacattcaggat
caacttgaacgaatatttctggttcttggaacaccaaatgaggacacatggcctggagtt
cattctttaccacattttaagccagaacgctttaccctgtacagctctaaaaaccttaga
caagcatggaataagctcagctatgtgaaccatgcagaggacctggcctccaagctccta
caatgttccccaaagaacagactgtcggcacaggctgccttgagccacgagtattttagt
gacctgccgccacggctatgggaactcaccgacatgtcttctatttttactgtcccaaat
gtgagattgcaaccagaagctggagaaagcatgcgggcctttgggaaaaacaatagttat
ggcaaaagtctatcaaacagcaagcactga

DBGET integrated database retrieval system