KEGG   Homo sapiens (human): 5223Help
Entry
5223              CDS       T01001                                 

Gene name
PGAM1, HEL-S-35, PGAM-B, PGAMA
Definition
phosphoglycerate mutase 1 (brain) (EC:3.1.3.13 5.4.2.4 5.4.2.11)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5223 (PGAM1)
   01230 Biosynthesis of amino acids
    5223 (PGAM1)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5223 (PGAM1)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    5223 (PGAM1)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    5223 (PGAM1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    5223 (PGAM1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     5223 (PGAM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   5223 (PGAM1)
  Exosomal proteins of melanoma cells
   5223 (PGAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q25.3
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacaaactggtgctgatccggcacggcgagagcgcatggaacctggagaac
cgcttcagcggctggtacgacgccgacctgagcccggcgggccacgaggaggcgaagcgc
ggcgggcaggcgctacgagatgctggctatgagtttgacatctgcttcacctcagtgcag
aagagagcgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtggtgaggacttggcgcctcaatgagcggcactatgggggtctaaccggtctcaataaa
gcagaaactgctgcaaagcatggtgaggcccaggtgaagatctggaggcgctcctatgat
gtcccaccacctccgatggagcccgaccatcctttctacagcaacatcagtaaggatcgc
aggtatgcagacctcacagaagatcagctaccctcctgtgagagtctgaaggatactatt
gccagagctctgcccttctggaatgaagaaatagttccccagatcaaggaggggaaacgt
gtactgattgcagcccatggcaacagcctccggggcattgtcaagcatctggagggtctc
tctgaagaggctatcatggagctgaacctgccgactggtattcccattgtctatgaattg
gacaagaacttgaagcctatcaagcccatgcagtttctgggggatgaagagacggtgcgc
aaagccatggaagctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system