KEGG   Homo sapiens (human): 5223Help
Entry
5223              CDS       T01001                                 

Gene name
PGAM1, HEL-S-35, PGAM-B, PGAMA
Definition
phosphoglycerate mutase 1 (brain) (EC:3.1.3.13 5.4.2.4 5.4.2.11)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:hsa00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q25.3
AA seq 254 aa AA seqDB search
MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQ
KRAIRTLWTVLDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYD
VPPPPMEPDHPFYSNISKDRRYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKR
VLIAAHGNSLRGIVKHLEGLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVR
KAMEAVAAQGKAKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggccgcctacaaactggtgctgatccggcacggcgagagcgcatggaacctggagaac
cgcttcagcggctggtacgacgccgacctgagcccggcgggccacgaggaggcgaagcgc
ggcgggcaggcgctacgagatgctggctatgagtttgacatctgcttcacctcagtgcag
aagagagcgatccggaccctctggacagtgctagatgccattgatcagatgtggctgcca
gtggtgaggacttggcgcctcaatgagcggcactatgggggtctaaccggtctcaataaa
gcagaaactgctgcaaagcatggtgaggcccaggtgaagatctggaggcgctcctatgat
gtcccaccacctccgatggagcccgaccatcctttctacagcaacatcagtaaggatcgc
aggtatgcagacctcacagaagatcagctaccctcctgtgagagtctgaaggatactatt
gccagagctctgcccttctggaatgaagaaatagttccccagatcaaggaggggaaacgt
gtactgattgcagcccatggcaacagcctccggggcattgtcaagcatctggagggtctc
tctgaagaggctatcatggagctgaacctgccgactggtattcccattgtctatgaattg
gacaagaacttgaagcctatcaagcccatgcagtttctgggggatgaagagacggtgcgc
aaagccatggaagctgtggctgcccagggcaaggccaagaagtga

DBGET integrated database retrieval system