KEGG   Homo sapiens (human): 5224Help
Entry
5224              CDS       T01001                                 

Gene name
PGAM2, GSD10, PGAM-M, PGAMM
Definition
phosphoglycerate mutase 2 (muscle) (EC:3.1.3.13 5.4.2.4 5.4.2.11)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Disease
H00069  
Glycogen storage diseases (GSD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5224 (PGAM2)
   01230 Biosynthesis of amino acids
    5224 (PGAM2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5224 (PGAM2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    5224 (PGAM2)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    5224 (PGAM2)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     5224 (PGAM2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   5224 (PGAM2)
  Exosomal proteins of melanoma cells
   5224 (PGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7p13-p12
AA seq 253 aa AA seqDB search
MATHRLVMVRHGESTWNQENRFCGWFDAELSEKGTEEAKRGAKAIKDAKMEFDICYTSVL
KRAIRTLWAILDGTDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEEQVKIWRRSFD
IPPPPMDEKHPYYNSISKERRYAGLKPGELPTCESLKDTIARALPFWNEEIVPQIKAGKR
VLIAAHGNSLRGIVKHLEGMSDQAIMELNLPTGIPIVYELNKELKPTKPMQFLGDEETVR
KAMEAVAAQGKAK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggccactcaccgcctcgtgatggtccggcacggcgagagcacatggaaccaggagaac
cgtttctgtggctggttcgatgcagagctgagtgaaaaggggaccgaggaggccaagcgg
ggagccaaggccatcaaggatgccaagatggagtttgacatctgctacacgtcagtgctg
aagcgggccatccgcaccctctgggccatcctggacggcacggaccagatgtggctgcct
gtggtgcgcacttggcgcctcaatgagcggcattacgggggcctcacaggcctcaacaag
gcagaaacggccgccaagcacggggaggagcaggtgaagatctggaggcgctccttcgac
atcccgccgcccccgatggacgagaagcacccctactacaactccattagcaaggagcgt
cggtacgcaggcctgaagcccggggaactccccacctgcgagagcctcaaggacaccatt
gcccgggccctgcccttctggaacgaggagattgttccccagatcaaggccggcaagcga
gtgctcattgcagcccacgggaacagcctgcggggcattgtcaagcacctggaagggatg
tcagaccaggcgatcatggagctgaacctgcccacggggatccccattgtgtatgagctg
aacaaggagctgaagcccaccaagcccatgcagttcctgggtgatgaggaaacggtgcgg
aaggccatggaggctgtggctgcccagggcaaggccaagtga

DBGET integrated database retrieval system