KEGG   Homo sapiens (human): 5226Help
Entry
5226              CDS       T01001                                 

Gene name
PGD, 6PGD
Definition
phosphogluconate dehydrogenase (EC:1.1.1.44)
Orthology
K00033  
6-phosphogluconate dehydrogenase [EC:1.1.1.44]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5226 (PGD)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    5226 (PGD)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    5226 (PGD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     5226 (PGD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.22
AA seq 483 aa AA seqDB search
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagctgacatcgcgctgatcggattggccgtcatgggccagaacttaattctg
aacatgaatgaccacggctttgtggtctgtgcttttaataggactgtctccaaagttgat
gatttcttggccaatgaggcaaagggaaccaaagtggtgggtgcccagtccctgaaagag
atggtctccaagctgaagaagccccggcggatcatcctcctggtgaaggctgggcaagct
gtggatgatttcatcgagaaattggtaccattgttggatactggtgacatcatcattgac
ggaggaaattctgaatatagggacaccacaagacggtgccgagacctcaaggccaaggga
attttatttgtggggagcggagtcagtggtggagaggaaggggcccggtatggcccatcg
ctcatgccaggagggaacaaagaagcgtggccccacatcaagaccatcttccaaggcatt
gctgcaaaagtgggaactggagaaccctgctgtgactgggtgggagatgagggagcaggc
cacttcgtgaagatggtgcacaacgggatagagtatggggacatgcagctgatctgtgag
gcataccacctgatgaaagacgtgctgggcatggcgcaggacgagatggcccaggccttt
gaggattggaataagacagagctagactcattcctgattgaaatcacagccaatattctc
aagttccaagacaccgatggcaaacacctgctgccaaagatcagggacagcgcggggcag
aagggcacagggaagtggaccgccatctccgccctggaatacggcgtacccgtcaccctc
attggagaagctgtctttgctcggtgcttatcatctctgaaggatgagagaattcaagct
agcaaaaagctgaagggtccccagaagttccagtttgatggtgataagaaatcattcctg
gaggacattcggaaggcactctacgcttccaagatcatctcttacgctcaaggctttatg
ctgctaaggcaggcagccaccgagtttggctggactctcaattatggtggcatcgccctg
atgtggagagggggctgcatcattagaagtgtattcctaggaaagataaaggatgcattt
gatcgaaacccggaacttcagaacctcctactggacgacttctttaagtcagctgttgaa
aactgccaggactcctggcggcgggcagtcagcactggggtccaggctggcattcccatg
ccctgttttaccactgccctctccttctatgacgggtacagacatgagatgcttccagcc
agcctcatccaggctcagcgggattacttcggggctcacacctatgaactcttggccaaa
ccagggcagtttatccacaccaactggacaggccatggtggcaccgtgtcatcctcgtca
tacaatgcctga

DBGET integrated database retrieval system