KEGG   Homo sapiens (human): 5226Help
Entry
5226              CDS       T01001                                 

Gene name
PGD, 6PGD
Definition
phosphogluconate dehydrogenase (EC:1.1.1.44)
Orthology
K00033  
6-phosphogluconate dehydrogenase [EC:1.1.1.44]
Organism
hsa  Homo sapiens (human)
Pathway
Pentose phosphate pathway
Glutathione metabolism
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5226 (PGD)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    5226 (PGD)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    5226 (PGD)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     5226 (PGD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p36.22
AA seq 483 aa AA seqDB search
MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKE
MVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKG
ILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAG
HFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANIL
KFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQA
SKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIAL
MWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPM
PCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSS
YNA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atggcccaagctgacatcgcgctgatcggattggccgtcatgggccagaacttaattctg
aacatgaatgaccacggctttgtggtctgtgcttttaataggactgtctccaaagttgat
gatttcttggccaatgaggcaaagggaaccaaagtggtgggtgcccagtccctgaaagag
atggtctccaagctgaagaagccccggcggatcatcctcctggtgaaggctgggcaagct
gtggatgatttcatcgagaaattggtaccattgttggatactggtgacatcatcattgac
ggaggaaattctgaatatagggacaccacaagacggtgccgagacctcaaggccaaggga
attttatttgtggggagcggagtcagtggtggagaggaaggggcccggtatggcccatcg
ctcatgccaggagggaacaaagaagcgtggccccacatcaagaccatcttccaaggcatt
gctgcaaaagtgggaactggagaaccctgctgtgactgggtgggagatgagggagcaggc
cacttcgtgaagatggtgcacaacgggatagagtatggggacatgcagctgatctgtgag
gcataccacctgatgaaagacgtgctgggcatggcgcaggacgagatggcccaggccttt
gaggattggaataagacagagctagactcattcctgattgaaatcacagccaatattctc
aagttccaagacaccgatggcaaacacctgctgccaaagatcagggacagcgcggggcag
aagggcacagggaagtggaccgccatctccgccctggaatacggcgtacccgtcaccctc
attggagaagctgtctttgctcggtgcttatcatctctgaaggatgagagaattcaagct
agcaaaaagctgaagggtccccagaagttccagtttgatggtgataagaaatcattcctg
gaggacattcggaaggcactctacgcttccaagatcatctcttacgctcaaggctttatg
ctgctaaggcaggcagccaccgagtttggctggactctcaattatggtggcatcgccctg
atgtggagagggggctgcatcattagaagtgtattcctaggaaagataaaggatgcattt
gatcgaaacccggaacttcagaacctcctactggacgacttctttaagtcagctgttgaa
aactgccaggactcctggcggcgggcagtcagcactggggtccaggctggcattcccatg
ccctgttttaccactgccctctccttctatgacgggtacagacatgagatgcttccagcc
agcctcatccaggctcagcgggattacttcggggctcacacctatgaactcttggccaaa
ccagggcagtttatccacaccaactggacaggccatggtggcaccgtgtcatcctcgtca
tacaatgcctga

DBGET integrated database retrieval system