KEGG   Homo sapiens (human): 5232Help
Entry
5232              CDS       T01001                                 

Gene name
PGK2, HEL-S-272, PGKB, PGKPS, dJ417L20.2
Definition
phosphoglycerate kinase 2 (EC:2.7.2.3)
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5232 (PGK2)
   01230 Biosynthesis of amino acids
    5232 (PGK2)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5232 (PGK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     5232 (PGK2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5232 (PGK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p12.3
AA seq 417 aa AA seqDB search
MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVL
MSHLGRPDGVPMPDKYSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACANPAPGSVILLE
NLRFHVEEEGKGQDPSGKKIKAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPHKASGFLMKKELDYFAKALENPVRPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGM
AYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGK
ATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV
KATSKGCITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttctaagaagttgactttagacaaactggatgttagagggaagcgagtcatc
atgagagtagacttcaatgttcccatgaagaagaaccagattacaaacaaccagaggatc
aaggcttccatcccaagcatcaagtactgcctggacaatggagccaaggcagtagttctt
atgagtcatctaggtcggcctgatggtgttcccatgcctgacaaatattccttagcacct
gttgctgttgagctcaaatccttgctgggcaaggatgttctgttcctgaaggactgtgta
ggcgcagaagtggagaaagcctgtgccaacccagctcctggttcagtcatcctgctggag
aacctgcgctttcatgtggaggaagaagggaagggccaagatccctctggaaagaagatt
aaagctgagccagataaaatagaagccttccgagcatcactttccaagctaggggacgtc
tatgtcaatgatgcttttggcactgcacaccgcgctcatagttccatggtgggagtgaat
ctgccccataaagcatccggattcttgatgaagaaggaactagattactttgctaaagcc
ttggaaaacccagtgagaccctttctggctatacttggtggagccaaagtggcagacaag
atccaacttatcaaaaatatgctggacaaagtcaatgagatgattattggtggtggaatg
gcttataccttccttaaggtactcaacaacatggagattggtgcttccctgtttgatgaa
gagggagccaagatcgttaaagatatcatggccaaagcacaaaagaatggtgtaaggatt
acttttcctgttgattttgttactggggacaagtttgacgagaacgctcaggttggaaaa
gccactgtagcatctggcatatctcctggctggatgggtttggactgtggtcctgagagc
aacaagaatcatgctcaagttgtggctcaagcaaggctaattgtttggaatgggccgtta
ggagtatttgaatgggatgcctttgctaagggaaccaaagccctcatggatgaaattgtg
aaagccacttccaagggctgcatcactgttatagggggtggagacactgctacttgctgt
gccaaatggaacactgaagataaagtcagccatgtcagcactggaggcggtgccagtcta
gagcttctggaaggtaaaatccttcctggagtagaggccctcagcaacatgtag

DBGET integrated database retrieval system