KEGG   Homo sapiens (human): 5232Help
Entry
5232              CDS       T01001                                 

Gene name
PGK2, HEL-S-272, PGKB, PGKPS, dJ417L20.2
Definition
phosphoglycerate kinase 2 (EC:2.7.2.3)
Orthology
K00927  
phosphoglycerate kinase [EC:2.7.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p12.3
AA seq 417 aa AA seqDB search
MSLSKKLTLDKLDVRGKRVIMRVDFNVPMKKNQITNNQRIKASIPSIKYCLDNGAKAVVL
MSHLGRPDGVPMPDKYSLAPVAVELKSLLGKDVLFLKDCVGAEVEKACANPAPGSVILLE
NLRFHVEEEGKGQDPSGKKIKAEPDKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPHKASGFLMKKELDYFAKALENPVRPFLAILGGAKVADKIQLIKNMLDKVNEMIIGGGM
AYTFLKVLNNMEIGASLFDEEGAKIVKDIMAKAQKNGVRITFPVDFVTGDKFDENAQVGK
ATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGPLGVFEWDAFAKGTKALMDEIV
KATSKGCITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttctaagaagttgactttagacaaactggatgttagagggaagcgagtcatc
atgagagtagacttcaatgttcccatgaagaagaaccagattacaaacaaccagaggatc
aaggcttccatcccaagcatcaagtactgcctggacaatggagccaaggcagtagttctt
atgagtcatctaggtcggcctgatggtgttcccatgcctgacaaatattccttagcacct
gttgctgttgagctcaaatccttgctgggcaaggatgttctgttcctgaaggactgtgta
ggcgcagaagtggagaaagcctgtgccaacccagctcctggttcagtcatcctgctggag
aacctgcgctttcatgtggaggaagaagggaagggccaagatccctctggaaagaagatt
aaagctgagccagataaaatagaagccttccgagcatcactttccaagctaggggacgtc
tatgtcaatgatgcttttggcactgcacaccgcgctcatagttccatggtgggagtgaat
ctgccccataaagcatccggattcttgatgaagaaggaactagattactttgctaaagcc
ttggaaaacccagtgagaccctttctggctatacttggtggagccaaagtggcagacaag
atccaacttatcaaaaatatgctggacaaagtcaatgagatgattattggtggtggaatg
gcttataccttccttaaggtactcaacaacatggagattggtgcttccctgtttgatgaa
gagggagccaagatcgttaaagatatcatggccaaagcacaaaagaatggtgtaaggatt
acttttcctgttgattttgttactggggacaagtttgacgagaacgctcaggttggaaaa
gccactgtagcatctggcatatctcctggctggatgggtttggactgtggtcctgagagc
aacaagaatcatgctcaagttgtggctcaagcaaggctaattgtttggaatgggccgtta
ggagtatttgaatgggatgcctttgctaagggaaccaaagccctcatggatgaaattgtg
aaagccacttccaagggctgcatcactgttatagggggtggagacactgctacttgctgt
gccaaatggaacactgaagataaagtcagccatgtcagcactggaggcggtgccagtcta
gagcttctggaaggtaaaatccttcctggagtagaggccctcagcaacatgtag

DBGET integrated database retrieval system