KEGG   Homo sapiens (human): 5244Help
Entry
5244              CDS       T01001                                 

Gene name
ABCB4, ABC21, GBD1, ICP3, MDR2, MDR2/3, MDR3, PFIC-3, PGY3
Definition
ATP-binding cassette, sub-family B (MDR/TAP), member 4 (EC:3.6.3.44)
Orthology
K05659  
ATP-binding cassette, subfamily B (MDR/TAP), member 4 [EC:3.6.3.44]
Organism
hsa  Homo sapiens (human)
Pathway
ABC transporters
Bile secretion
Disease
H00624  
Familial cholestasis
H01213  
Gallbladder disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    5244 (ABCB4)
 Organismal Systems
  Digestive system
   04976 Bile secretion
    5244 (ABCB4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.44  xenobiotic-transporting ATPase
     5244 (ABCB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
7q21.1
AA seq 1279 aa AA seqDB search
MDLEAAKNGTAWRPTSAEGDFELGISSKQKRKKTKTVKMIGVLTLFRYSDWQDKLFMSLG
TIMAIAHGSGLPLMMIVFGEMTDKFVDTAGNFSFPVNFSLSLLNPGKILEEEMTRYAYYY
SGLGAGVLVAAYIQVSFWTLAAGRQIRKIRQKFFHAILRQEIGWFDINDTTELNTRLTDD
ISKISEGIGDKVGMFFQAVATFFAGFIVGFIRGWKLTLVIMAISPILGLSAAVWAKILSA
FSDKELAAYAKAGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANIS
MGIAFLLIYASYALAFWYGSTLVISKEYTIGNAMTVFFSILIGAFSVGQAAPCIDAFANA
RGAAYVIFDIIDNNPKIDSFSERGHKPDSIKGNLEFNDVHFSYPSRANVKILKGLNLKVQ
SGQTVALVGSSGCGKSTTVQLIQRLYDPDEGTINIDGQDIRNFNVNYLREIIGVVSQEPV
LFSTTIAENICYGRGNVTMDEIKKAVKEANAYEFIMKLPQKFDTLVGERGAQLSGGQKQR
IAIARALVRNPKILLLDEATSALDTESEAEVQAALDKAREGRTTIVIAHRLSTVRNADVI
AGFEDGVIVEQGSHSELMKKEGVYFKLVNMQTSGSQIQSEEFELNDEKAATRMAPNGWKS
RLFRHSTQKNLKNSQMCQKSLDVETDGLEANVPPVSFLKVLKLNKTEWPYFVVGTVCAIA
NGGLQPAFSVIFSEIIAIFGPGDDAVKQQKCNIFSLIFLFLGIISFFTFFLQGFTFGKAG
EILTRRLRSMAFKAMLRQDMSWFDDHKNSTGALSTRLATDAAQVQGATGTRLALIAQNIA
NLGTGIIISFIYGWQLTLLLLAVVPIIAVSGIVEMKLLAGNAKRDKKELEAAGKIATEAI
ENIRTVVSLTQERKFESMYVEKLYGPYRNSVQKAHIYGITFSISQAFMYFSYAGCFRFGA
YLIVNGHMRFRDVILVFSAIVFGAVALGHASSFAPDYAKAKLSAAHLFMLFERQPLIDSY
SEEGLKPDKFEGNITFNEVVFNYPTRANVPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQ
LLERFYDPLAGTVLLDGQEAKKLNVQWLRAQLGIVSQEPILFDCSIAENIAYGDNSRVVS
QDEIVSAAKAANIHPFIETLPHKYETRVGDKGTQLSGGQKQRIAIARALIRQPQILLLDE
ATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLL
AQKGIYFSMVSVQAGTQNL
NT seq 3840 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgaggcggcaaagaacggaacagcctggcgccccacgagcgcggagggcgac
tttgaactgggcatcagcagcaaacaaaaaaggaaaaaaacgaagacagtgaaaatgatt
ggagtattaacattgtttcgatactccgattggcaggataaattgtttatgtcgctgggt
accatcatggccatagctcacggatcaggtctccccctcatgatgatagtatttggagag
atgactgacaaatttgttgatactgcaggaaacttctcctttccagtgaacttttccttg
tcgctgctaaatccaggcaaaattctggaagaagaaatgactagatatgcatattactac
tcaggattgggtgctggagttcttgttgctgcctatatacaagtttcattttggactttg
gcagctggtcgacagatcaggaaaattaggcagaagttttttcatgctattctacgacag
gaaataggatggtttgacatcaacgacaccactgaactcaatacgcggctaacagatgac
atctccaaaatcagtgaaggaattggtgacaaggttggaatgttctttcaagcagtagcc
acgttttttgcaggattcatagtgggattcatcagaggatggaagctcacccttgtgata
atggccatcagccctattctaggactctctgcagccgtttgggcaaagatactctcggca
tttagtgacaaagaactagctgcttatgcaaaagcaggcgccgtggcagaagaggctctg
ggggccatcaggactgtgatagctttcgggggccagaacaaagagctggaaaggtatcag
aaacatttagaaaatgccaaagagattggaattaaaaaagctatttcagcaaacatttcc
atgggtattgccttcctgttaatatatgcatcatatgcactggccttctggtatggatcc
actctagtcatatcaaaagaatatactattggaaatgcaatgacagtttttttttcaatc
ctaattggagctttcagtgttggccaggctgccccatgtattgatgcttttgccaatgca
agaggagcagcatatgtgatctttgatattattgataataatcctaaaattgacagtttt
tcagagagaggacacaaaccagacagcatcaaagggaatttggagttcaatgatgttcac
ttttcttacccttctcgagctaacgtcaagatcttgaagggcctcaacctgaaggtgcag
agtgggcagacggtggccctggttggaagtagtggctgtgggaagagcacaacggtccag
ctgatacagaggctctatgaccctgatgagggcacaattaacattgatgggcaggatatt
aggaactttaatgtaaactatctgagggaaatcattggtgtggtgagtcaggagccggtg
ctgttttccaccacaattgctgaaaatatttgttatggccgtggaaatgtaaccatggat
gagataaagaaagctgtcaaagaggccaacgcctatgagtttatcatgaaattaccacag
aaatttgacaccctggttggagagagaggggcccagctgagtggtgggcagaagcagagg
atcgccattgcacgtgccctggttcgcaaccccaagatccttctgctggatgaggccacg
tcagcattggacacagaaagtgaagctgaggtacaggcagctctggataaggccagagaa
ggccggaccaccattgtgatagcacaccgactgtctacggtccgaaatgcagatgtcatc
gctgggtttgaggatggagtaattgtggagcaaggaagccacagcgaactgatgaagaag
gaaggggtgtacttcaaacttgtcaacatgcagacatcaggaagccagatccagtcagaa
gaatttgaactaaatgatgaaaaggctgccactagaatggccccaaatggctggaaatct
cgcctatttaggcattctactcagaaaaaccttaaaaattcacaaatgtgtcagaagagc
cttgatgtggaaaccgatggacttgaagcaaatgtgccaccagtgtcctttctgaaggtc
ctgaaactgaataaaacagaatggccctactttgtcgtgggaacagtatgtgccattgcc
aatggggggcttcagccggcattttcagtcatattctcagagatcatagcgatttttgga
ccaggcgatgatgcagtgaagcagcagaagtgcaacatattctctttgattttcttattt
ctgggaattatttctttttttactttcttccttcagggtttcacgtttgggaaagctggc
gagatcctcaccagaagactgcggtcaatggcttttaaagcaatgctaagacaggacatg
agctggtttgatgaccataaaaacagtactggtgcactttctacaagacttgccacagat
gctgcccaagtccaaggagccacaggaaccaggttggctttaattgcacagaatatagct
aaccttggaactggtattatcatatcatttatctacggttggcagttaaccctattgcta
ttagcagttgttccaattattgctgtgtcaggaattgttgaaatgaaattgttggctgga
aatgccaaaagagataaaaaagaactggaagctgctggaaagattgcaacagaggcaata
gaaaatattaggacagttgtgtctttgacccaggaaagaaaatttgaatcaatgtatgtt
gaaaaattgtatggaccttacaggaattctgtgcagaaggcacacatctatggaattact
tttagtatctcacaagcatttatgtatttttcctatgccggttgttttcgatttggtgca
tatctcattgtgaatggacatatgcgcttcagagatgttattctggtgttttctgcaatt
gtatttggtgcagtggctctaggacatgccagttcatttgctccagactatgctaaagct
aagctgtctgcagcccacttattcatgctgtttgaaagacaacctctgattgacagctac
agtgaagaggggctgaagcctgataaatttgaaggaaatataacatttaatgaagtcgtg
ttcaactatcccacccgagcaaacgtgccagtgcttcaggggctgagcctggaggtgaag
aaaggccagacactagccctggtgggcagcagtggctgtgggaagagcacggtggtccag
ctcctggagcggttctacgaccccttggcggggacagtgcttctcgatggtcaagaagca
aagaaactcaatgtccagtggctcagagctcaactcggaatcgtgtctcaggagcctatc
ctatttgactgcagcattgccgagaatattgcctatggagacaacagccgggttgtatca
caggatgaaattgtgagtgcagccaaagctgccaacatacatcctttcatcgagacgtta
ccccacaaatatgaaacaagagtgggagataaggggactcagctctcaggaggtcaaaaa
cagaggattgctattgcccgagccctcatcagacaacctcaaatcctcctgttggatgaa
gctacatcagctctggatactgaaagtgaaaaggttgtccaagaagccctggacaaagcc
agagaaggccgcacctgcattgtgattgctcaccgcctgtccaccatccagaatgcagac
ttaatagtggtgtttcagaatgggagagtcaaggagcatggcacgcatcagcagctgctg
gcacagaaaggcatctatttttcaatggtcagtgtccaggctgggacacagaacttatga

DBGET integrated database retrieval system