KEGG   Homo sapiens (human): 525Help
Entry
525               CDS       T01001                                 

Gene name
ATP6V1B1, ATP6B1, RTA1B, VATB, VMA2, VPP3
Definition
ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1 (EC:3.6.3.14)
Orthology
K02147  
V-type H+-transporting ATPase subunit B
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Disease
H00428  
Distal renal tubular acidosis (RTA type 1)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    525 (ATP6V1B1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    525 (ATP6V1B1)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    525 (ATP6V1B1)
  Nervous system
   04721 Synaptic vesicle cycle
    525 (ATP6V1B1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    525 (ATP6V1B1)
  Infectious diseases
   05110 Vibrio cholerae infection
    525 (ATP6V1B1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    525 (ATP6V1B1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   525 (ATP6V1B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13.1
AA seq 513 aa AA seqDB search
MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFA
QYAEIVHFTLPDGTQRSGQVLEVAGTKAIVQVFEGTSGIDARKTTCEFTGDILRTPVSED
MLGRVFNGSGKPIDKGPVVMAEDFLDINGQPINPHSRIYPEEMIQTGISPIDVMNSIARG
QKIPIFSAAGLPHNEIAAQICRQAGLVKKSKAVLDYHDDNFAIVFAAMGVNMETARFFKS
DFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEA
LREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTMPNDDITHPIP
DLTGFITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACY
AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFINQGPYENRSVFESLDLGWKLLRI
FPKEMLKRIPQAVIDEFYSREGALQDLAPDTAL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggccatggagatagacagcaggcctggggggctccccggcagtagctgcaacctaggt
gcagcccgagaacacatgcaggcggtcacccgaaactacatcacccacccccgtgtcacc
tacaggactgtgtgcagcgtgaacgggcccctggtggtgctggaccgggtcaagtttgcc
cagtatgcggagatcgtccacttcaccctcccagatgggactcagaggagcgggcaggtg
cttgaggtggctggcaccaaggcgattgttcaggtgtttgaagggacatcagggatcgat
gccaggaagaccacttgcgaatttacaggggacatcctacgaactccggtgtcagaggac
atgctgggtcgggttttcaatggctccggcaagcccattgacaaggggccagtggtcatg
gcggaggactttctggatatcaatggccagcccatcaacccgcactcccgcatctacccc
gaggagatgattcagacgggcatttctcctattgacgtcatgaacagcattgcccgcggc
cagaagatccccatcttctcagcagccgggctcccccacaatgagattgccgctcagatc
tgccgccaggcggggctggtgaagaagtccaaggctgtgctggattaccatgacgacaac
ttcgccatcgtctttgcagccatgggggtgaacatggagacagccagattcttcaagtct
gactttgagcagaatggaaccatggggaacgtctgcctcttcctgaacttggccaatgac
cccacgatcgagcggatcatcaccccgcgcctggcgctgaccactgctgaattccttgcc
taccagtgtgagaagcatgtgctggtcatactgacggacatgagttcctatgcagaggcc
ttgcgggaggtctctgctgctagagaggaggtgcctgggcgccgagggtttcctggatat
atgtacacagacctggccaccatctacgagcgggcgggccgcgtggagggtcggggagga
tccatcacacagatccccatcctcaccatgcccaacgacgatatcacccaccctatccca
gacttgacgggcttcatcacagagggacagatctacgtggacagacagcttcacaacaga
cagatctacccccccatcaacgtgctcccttccctgtcgcggctgatgaagtcagccatt
ggggaaggcatgacaagaaaggaccatggagatgtctccaaccagctgtacgcctgctat
gccatcgggaaggacgtgcaggccatgaaggcagtagttggggaggaggcgctcacctct
gaggacctgctctacctggaattcctgcagaagtttgagaagaacttcatcaatcagggc
ccctacgagaaccgctcggtgttcgagtcgctggacctgggctggaagctgctgcgcatc
ttccccaaggagatgctgaagcgcattccgcaggccgtgatcgacgagttctattcccgc
gagggggcgctgcaggacctcgcgcctgacactgcgctctag

DBGET integrated database retrieval system