KEGG   Homo sapiens (human): 525Help
Entry
525               CDS       T01001                                 

Gene name
ATP6V1B1, ATP6B1, RTA1B, VATB, VMA2, VPP3
Definition
ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B1 (EC:3.6.3.14)
Orthology
K02147  
V-type H+-transporting ATPase subunit B
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Disease
H00428  
Distal renal tubular acidosis (RTA type 1)
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Organismal Systems; Excretory system; Collecting duct acid secretion [PATH:hsa04966]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:hsa05110]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
2p13.1
AA seq 513 aa AA seqDB search
MAMEIDSRPGGLPGSSCNLGAAREHMQAVTRNYITHPRVTYRTVCSVNGPLVVLDRVKFA
QYAEIVHFTLPDGTQRSGQVLEVAGTKAIVQVFEGTSGIDARKTTCEFTGDILRTPVSED
MLGRVFNGSGKPIDKGPVVMAEDFLDINGQPINPHSRIYPEEMIQTGISPIDVMNSIARG
QKIPIFSAAGLPHNEIAAQICRQAGLVKKSKAVLDYHDDNFAIVFAAMGVNMETARFFKS
DFEQNGTMGNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDMSSYAEA
LREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRGGSITQIPILTMPNDDITHPIP
DLTGFITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHGDVSNQLYACY
AIGKDVQAMKAVVGEEALTSEDLLYLEFLQKFEKNFINQGPYENRSVFESLDLGWKLLRI
FPKEMLKRIPQAVIDEFYSREGALQDLAPDTAL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggccatggagatagacagcaggcctggggggctccccggcagtagctgcaacctaggt
gcagcccgagaacacatgcaggcggtcacccgaaactacatcacccacccccgtgtcacc
tacaggactgtgtgcagcgtgaacgggcccctggtggtgctggaccgggtcaagtttgcc
cagtatgcggagatcgtccacttcaccctcccagatgggactcagaggagcgggcaggtg
cttgaggtggctggcaccaaggcgattgttcaggtgtttgaagggacatcagggatcgat
gccaggaagaccacttgcgaatttacaggggacatcctacgaactccggtgtcagaggac
atgctgggtcgggttttcaatggctccggcaagcccattgacaaggggccagtggtcatg
gcggaggactttctggatatcaatggccagcccatcaacccgcactcccgcatctacccc
gaggagatgattcagacgggcatttctcctattgacgtcatgaacagcattgcccgcggc
cagaagatccccatcttctcagcagccgggctcccccacaatgagattgccgctcagatc
tgccgccaggcggggctggtgaagaagtccaaggctgtgctggattaccatgacgacaac
ttcgccatcgtctttgcagccatgggggtgaacatggagacagccagattcttcaagtct
gactttgagcagaatggaaccatggggaacgtctgcctcttcctgaacttggccaatgac
cccacgatcgagcggatcatcaccccgcgcctggcgctgaccactgctgaattccttgcc
taccagtgtgagaagcatgtgctggtcatactgacggacatgagttcctatgcagaggcc
ttgcgggaggtctctgctgctagagaggaggtgcctgggcgccgagggtttcctggatat
atgtacacagacctggccaccatctacgagcgggcgggccgcgtggagggtcggggagga
tccatcacacagatccccatcctcaccatgcccaacgacgatatcacccaccctatccca
gacttgacgggcttcatcacagagggacagatctacgtggacagacagcttcacaacaga
cagatctacccccccatcaacgtgctcccttccctgtcgcggctgatgaagtcagccatt
ggggaaggcatgacaagaaaggaccatggagatgtctccaaccagctgtacgcctgctat
gccatcgggaaggacgtgcaggccatgaaggcagtagttggggaggaggcgctcacctct
gaggacctgctctacctggaattcctgcagaagtttgagaagaacttcatcaatcagggc
ccctacgagaaccgctcggtgttcgagtcgctggacctgggctggaagctgctgcgcatc
ttccccaaggagatgctgaagcgcattccgcaggccgtgatcgacgagttctattcccgc
gagggggcgctgcaggacctcgcgcctgacactgcgctctag

DBGET integrated database retrieval system