KEGG   Homo sapiens (human): 526Help
Entry
526               CDS       T01001                                 

Gene name
ATP6V1B2, ATP6B1B2, ATP6B2, DOOD, HO57, VATB, VPP3, Vma2, ZLS2
Definition
(RefSeq) ATPase H+ transporting V1 subunit B2
  KO
K02147  V-type H+-transporting ATPase subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04145  Phagosome
hsa04150  mTOR signaling pathway
hsa04721  Synaptic vesicle cycle
hsa04966  Collecting duct acid secretion
hsa05110  Vibrio cholerae infection
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05323  Rheumatoid arthritis
Module
hsa_M00160  V-type ATPase, eukaryotes
Disease
H01573  Zimmermann-Laband syndrome (ZLS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    526 (ATP6V1B2)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    526 (ATP6V1B2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    526 (ATP6V1B2)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    526 (ATP6V1B2)
  Nervous system
   04721 Synaptic vesicle cycle
    526 (ATP6V1B2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    526 (ATP6V1B2)
  Infectious diseases
   05110 Vibrio cholerae infection
    526 (ATP6V1B2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    526 (ATP6V1B2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   526 (ATP6V1B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N DUF2481
Motif
Other DBs
NCBI-GeneID: 526
NCBI-ProteinID: NP_001684
OMIM: 606939
HGNC: 854
Ensembl: ENSG00000147416
Vega: OTTHUMG00000131073
Pharos: P21281(Tbio)
UniProt: P21281 A0A140VK65
Position
8p21.3
AA seq 511 aa AA seqDB search
MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVIL
DHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILR
TPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGM
NSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMET
ARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDM
SSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDD
ITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSN
QLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFERNFIAQGPYENRTVFETLDIG
WQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgggcgatgcgggggattgtcaacggggccgcacccgagctacccgtgccc
accggtgggccggcggtgggagctcgggagcaggcgctggcagtcagtcggaactacctc
tcccagcctcgcctcacatacaagacagtatctggagtcaatggtccactagtgatctta
gatcatgttaagtttcccaggtatgctgaaattgtccatttgaccttaccggatggcaca
aagagaagtgggcaagttctggaagttagtggttccaaggcagtagttcaggtatttgaa
gggacttcaggtatagatgctaagaaaacgtcctgtgagtttactggggatattctccga
acaccggtgtctgaggatatgcttggtcgggtattcaatggatcgggaaaacccattgac
agaggtcctgttgtactggccgaagacttccttgatatcatgggtcagccaatcaaccct
caatgtcgaatctacccagaggaaatgattcagactggcatttcggccatcgatgggatg
aacagtattgctagggggcagaaaattcctatcttctctgctgctgggctaccacacaat
gagattgcagctcagatctgtcgccaggctggtttggtaaagaaatccaaagatgtagta
gactacagtgaggaaaattttgcaattgtatttgctgctatgggtgtaaacatggaaact
gcccggttcttcaaatctgactttgaagaaaatggctcaatggacaatgtctgcctcttt
ttgaacttggctaatgacccaaccattgagcgaattatcactcctcgcctggctctaacc
acagctgaatttctggcgtaccaatgtgagaaacatgtattggttattctaacagacatg
agttcttatgctgaagcacttcgagaggtttcagcagccagggaagaggtacctggtcga
cgaggttttccaggttacatgtatacagatttagccacgatatatgaacgcgctgggcga
gtggaagggagaaacggctcgattactcaaatccctattctaaccatgcctaatgatgat
atcactcaccccatcccagacttgactggctacattacagaggggcagatctatgtggac
agacagctgcacaacagacagatttatccacctatcaatgtgctgccctcactatcacgg
ttaatgaagtctgctattggagaagggatgaccaggaaggatcatgccgatgtatctaac
cagctatatgcgtgctatgctattggaaaggatgtgcaagccatgaaagctgtcgttgga
gaagaagcccttacctcagatgatcttctctacttggaatttctgcagaagtttgagagg
aacttcattgctcagggtccttacgaaaatcgcactgtctttgagactttggacattggc
tggcagctactccgaatcttccccaaagaaatgctgaagagaatccctcagagcaccctc
agcgaattttaccctcgagactctgcaaagcattag

DBGET integrated database retrieval system