KEGG   Homo sapiens (human): 526Help
Entry
526               CDS       T01001                                 

Gene name
ATP6V1B2, ATP6B1B2, ATP6B2, HO57, VATB, VPP3, Vma2
Definition
ATPase, H+ transporting, lysosomal 56/58kDa, V1 subunit B2 (EC:3.6.3.14)
Orthology
K02147  
V-type H+-transporting ATPase subunit B
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    526 (ATP6V1B2)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    526 (ATP6V1B2)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    526 (ATP6V1B2)
  Nervous system
   04721 Synaptic vesicle cycle
    526 (ATP6V1B2)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    526 (ATP6V1B2)
  Infectious diseases
   05110 Vibrio cholerae infection
    526 (ATP6V1B2)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    526 (ATP6V1B2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   526 (ATP6V1B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
8p21.3
AA seq 511 aa AA seqDB search
MALRAMRGIVNGAAPELPVPTGGPAVGAREQALAVSRNYLSQPRLTYKTVSGVNGPLVIL
DHVKFPRYAEIVHLTLPDGTKRSGQVLEVSGSKAVVQVFEGTSGIDAKKTSCEFTGDILR
TPVSEDMLGRVFNGSGKPIDRGPVVLAEDFLDIMGQPINPQCRIYPEEMIQTGISAIDGM
NSIARGQKIPIFSAAGLPHNEIAAQICRQAGLVKKSKDVVDYSEENFAIVFAAMGVNMET
ARFFKSDFEENGSMDNVCLFLNLANDPTIERIITPRLALTTAEFLAYQCEKHVLVILTDM
SSYAEALREVSAAREEVPGRRGFPGYMYTDLATIYERAGRVEGRNGSITQIPILTMPNDD
ITHPIPDLTGYITEGQIYVDRQLHNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHADVSN
QLYACYAIGKDVQAMKAVVGEEALTSDDLLYLEFLQKFERNFIAQGPYENRTVFETLDIG
WQLLRIFPKEMLKRIPQSTLSEFYPRDSAKH
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcgggcgatgcgggggattgtcaacggggccgcacccgagctacccgtgccc
accggtgggccggcggtgggagctcgggagcaggcgctggcagtcagtcggaactacctc
tcccagcctcgcctcacatacaagacagtatctggagtcaatggtccactagtgatctta
gatcatgttaagtttcccaggtatgctgaaattgtccatttgaccttaccggatggcaca
aagagaagtgggcaagttctggaagttagtggttccaaggcagtagttcaggtatttgaa
gggacttcaggtatagatgctaagaaaacgtcctgtgagtttactggggatattctccga
acaccggtgtctgaggatatgcttggtcgggtattcaatggatcgggaaaacccattgac
agaggtcctgttgtactggccgaagacttccttgatatcatgggtcagccaatcaaccct
caatgtcgaatctacccagaggaaatgattcagactggcatttcggccatcgatgggatg
aacagtattgctagggggcagaaaattcctatcttctctgctgctgggctaccacacaat
gagattgcagctcagatctgtcgccaggctggtttggtaaagaaatccaaagatgtagta
gactacagtgaggaaaattttgcaattgtatttgctgctatgggtgtaaacatggaaact
gcccggttcttcaaatctgactttgaagaaaatggctcaatggacaatgtctgcctcttt
ttgaacttggctaatgacccaaccattgagcgaattatcactcctcgcctggctctaacc
acagctgaatttctggcgtaccaatgtgagaaacatgtattggttattctaacagacatg
agttcttatgctgaagcacttcgagaggtttcagcagccagggaagaggtacctggtcga
cgaggttttccaggttacatgtatacagatttagccacgatatatgaacgcgctgggcga
gtggaagggagaaacggctcgattactcaaatccctattctaaccatgcctaatgatgat
atcactcaccccatcccagacttgactggctacattacagaggggcagatctatgtggac
agacagctgcacaacagacagatttatccacctatcaatgtgctgccctcactatcacgg
ttaatgaagtctgctattggagaagggatgaccaggaaggatcatgccgatgtatctaac
cagctatatgcgtgctatgctattggaaaggatgtgcaagccatgaaagctgtcgttgga
gaagaagcccttacctcagatgatcttctctacttggaatttctgcagaagtttgagagg
aacttcattgctcagggtccttacgaaaatcgcactgtctttgagactttggacattggc
tggcagctactccgaatcttccccaaagaaatgctgaagagaatccctcagagcaccctc
agcgaattttaccctcgagactctgcaaagcattag

DBGET integrated database retrieval system