KEGG   Homo sapiens (human): 5261Help
Entry
5261              CDS       T01001                                 

Gene name
PHKG2, GSD9C
Definition
(RefSeq) phosphorylase kinase catalytic subunit gamma 2
  KO
K00871  
phosphorylase kinase gamma subunit [EC:2.7.11.19]
Organism
hsa  Homo sapiens (human)
Pathway
Calcium signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Disease
H00069  
Glycogen storage diseases (GSD)
H01760  
Hepatic glycogen storage disease
H01948  
Glycogen storage disease type IX
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    5261 (PHKG2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    5261 (PHKG2)
   04922 Glucagon signaling pathway
    5261 (PHKG2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.19  phosphorylase kinase
     5261 (PHKG2)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  PHK family
   5261 (PHKG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P15735(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
16p11.2
AA seq 406 aa AA seqDB search
MTLDVGPEDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAE
RLSPEQLEEVREATRRETHILRQVAGHPHIITLIDSYESSSFMFLVFDLMRKGELFDYLT
EKVALSEKETRSIMRSLLEAVSFLHANNIVHRDLKPENILLDDNMQIRLSDFGFSCHLEP
GEKLRELCGTPGYLAPEILKCSMDETHPGYGKEVDLWACGVILFTLLAGSPPFWHRRQIL
MLRMIMEGQYQFSSPEWDDRSSTVKDLISRLLQVDPEARLTAEQALQHPFFERCEGSQPW
NLTPRQRFRVAVWTVLAAGRVALSTHRVRPLTKNALLRDPYALRSVRHLIDNCAFRLYGH
WVKKGEQQNRAALFQHRPPGPFPIMGPEEEGDSAAITEDEAVLVLG
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgacgctggacgtggggccggaggatgagctgcccgactgggccgccgccaaagagttt
taccagaagtacgaccctaaggacgtcatcggcagaggagtgagctctgtggtccgccgt
tgtgttcatcgagctactggccacgagtttgcggtgaagattatggaagtgacagctgag
cggctgagtcctgagcagctggaggaggtgcgggaagccacacggcgagagacacacatc
cttcgccaggtcgccggccacccccacatcatcaccctcatcgattcctacgagtcttct
agcttcatgttcctggtgtttgacctgatgcggaagggagagctgtttgactatctcaca
gagaaggtggccctctctgaaaaggaaaccaggtccatcatgcggtctctgctggaagca
gtgagctttctccatgccaacaacattgtgcatcgagatctgaagcccgagaatattctc
ctagatgacaatatgcagatccgactttcagatttcgggttctcctgccacttggaacct
ggcgagaagcttcgagagttgtgtgggaccccagggtatctagcgccagagatccttaaa
tgctccatggatgaaacccacccaggctatggcaaggaggtcgacctctgggcctgtggg
gtgatcttgttcacactcctggctggctcgccacccttctggcaccggcggcagatcctg
atgttacgcatgatcatggagggccagtaccagttcagttcccccgagtgggatgaccgt
tccagcactgtcaaagacctgatctccaggctgctgcaggtggatcctgaggcacgcctg
acagctgagcaggccctacagcaccccttctttgagcgttgtgaaggcagccaaccctgg
aacctcaccccccgccagcggttccgggtggcagtgtggacagtgctggctgctggacga
gtggccctaagcacccatcgtgtacggccactgaccaagaatgcactgttgagggaccct
tatgcgctgcggtcagtgcggcacctcatcgacaactgtgccttccggctctacgggcac
tgggtaaagaaaggggagcagcagaaccgggcggctctctttcagcaccggccccctggg
ccttttcccatcatgggccctgaagaggagggagactctgctgctataactgaggatgag
gccgtgcttgtgctgggctag

DBGET integrated database retrieval system