KEGG   Homo sapiens (human): 5268Help
Entry
5268              CDS       T01001                                 

Gene name
SERPINB5, PI5, maspin
Definition
serpin peptidase inhibitor, clade B (ovalbumin), member 5
Orthology
K10139  
serpin B5
Organism
hsa  Homo sapiens (human)
Pathway
p53 signaling pathway
MicroRNAs in cancer
Class
Cellular Processes; Cell growth and death; p53 signaling pathway [PATH:hsa04115]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:hsa05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
18q21.33
AA seq 375 aa AA seqDB search
MDALQLANSAFAVDLFKQLCEKEPLGNVLFSPICLSTSLSLAQVGAKGDTANEIGQVLHF
ENVKDVPFGFQTVTSDVNKLSSFYSLKLIKRLYVDKSLNLSTEFISSTKRPYAKELETVD
FKDKLEETKGQINNSIKDLTDGHFENILADNSVNDQTKILVVNAAYFVGKWMKKFSESET
KECPFRVNKTDTKPVQMMNMEATFCMGNIDSINCKIIELPFQNKHLSMFILLPKDVEDES
TGLEKIEKQLNSESLSQWTNPSTMANAKVKLSIPKFKVEKMIDPKACLENLGLKHIFSED
TSDFSGMSETKGVALSNVIHKVCLEITEDGGDSIEVPGARILQHKDELNADHPFIYIIRH
NKTRNIIFFGKFCSP
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggatgccctgcaactagcaaattcggcttttgccgttgatctgttcaaacaactatgt
gaaaaggagccactgggcaatgtcctcttctctccaatctgtctctccacctctctgtca
cttgctcaagtgggtgctaaaggtgacactgcaaatgaaattggacaggttcttcatttt
gaaaatgtcaaagatgtaccctttggatttcaaacagtaacatcggatgtaaacaaactt
agttccttttactcactgaaactaatcaagcggctctacgtagacaaatctctgaatctt
tctacagagttcatcagctctacgaagagaccgtatgcaaaggaattggaaactgttgac
ttcaaagataaattggaagaaacgaaaggtcagatcaacaactcaattaaggatctcaca
gatggccactttgagaacattttagctgacaacagtgtgaacgaccagaccaaaatcctt
gtggttaatgctgcctactttgttggcaagtggatgaagaaattttctgaatcagaaaca
aaagaatgtcctttcagagtcaacaagacagacaccaaaccagtgcagatgatgaacatg
gaggccacgttctgtatgggaaacattgacagtatcaattgtaagatcatagagcttcct
tttcaaaataagcatctcagcatgttcatcctactacccaaggatgtggaggatgagtcc
acaggcttggagaagattgaaaaacaactcaactcagagtcactgtcacagtggactaat
cccagcaccatggccaatgccaaggtcaaactctccattccaaaatttaaggtggaaaag
atgattgatcccaaggcttgtctggaaaatctagggctgaaacatatcttcagtgaagac
acatctgatttctctggaatgtcagagaccaagggagtggccctatcaaatgttatccac
aaagtgtgcttagaaataactgaagatggtggggattccatagaggtgccaggagcacgg
atcctgcagcacaaggatgaattgaatgctgaccatccctttatttacatcatcaggcac
aacaaaactcgaaacatcattttctttggcaaattctgttctccttaa

DBGET integrated database retrieval system