KEGG   Homo sapiens (human): 527Help
Entry
527               CDS       T01001                                 

Gene name
ATP6V0C, ATP6C, ATP6L, ATPL, VATL, VPPC, Vma3
Definition
ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c (EC:3.6.3.14)
Orthology
K02155  
V-type H+-transporting ATPase 16kDa proteolipid subunit
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    527 (ATP6V0C)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    527 (ATP6V0C)
   04142 Lysosome
    527 (ATP6V0C)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    527 (ATP6V0C)
  Nervous system
   04721 Synaptic vesicle cycle
    527 (ATP6V0C)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    527 (ATP6V0C)
  Infectious diseases
   05110 Vibrio cholerae infection
    527 (ATP6V0C)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    527 (ATP6V0C)
   05152 Tuberculosis
    527 (ATP6V0C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
16p13.3
AA seq 155 aa AA seqDB search
MSESKSGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVV
MAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRG
TAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgtccgagtccaagagcggccccgagtatgcttcgtttttcgccgtcatgggcgcctcg
gccgccatggtcttcagcgccctgggcgctgcctatggcacagccaagagcggtaccggc
attgcggccatgtctgtcatgcggccggagcagatcatgaagtccatcatcccagtggtc
atggctggcatcatcgccatctacggcctggtggtggcagtcctcatcgccaactccctg
aatgacgacatcagcctctacaagagcttcctccagctgggcgccggcctgagcgtgggc
ctgagcggcctggcagccggctttgccatcggcatcgtgggggacgctggcgtgcggggc
accgcccagcagccccgactattcgtgggcatgatcctgattctcatcttcgccgaggtg
ctcggcctctacggtctcatcgtcgccctcatcctctccacaaagtag

DBGET integrated database retrieval system