KEGG   Homo sapiens (human): 5272Help
Entry
5272              CDS       T01001                                 

Gene name
SERPINB9, CAP-3, CAP3, PI-9, PI9
Definition
serpin peptidase inhibitor, clade B (ovalbumin), member 9
Orthology
K13963  
serpin B
Organism
hsa  Homo sapiens (human)
Pathway
Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    5272 (SERPINB9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
6p25
AA seq 376 aa AA seqDB search
METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSL
NTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELS
FIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYT
REMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELS
TVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL
SAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIR
HNRANSILFCGRFSSP
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaaactctttctaatgcaagtggtacttttgccatacgccttttaaagatactgtgt
caagataacccttcgcacaacgtgttctgttctcctgtgagcatctcctctgccctggcc
atggttctcctaggggcaaagggaaacaccgcaacccagatggcccaggcactgtcttta
aacacagaggaagacattcatcgggctttccagtcgcttctcactgaagtgaacaaggct
ggcacacagtacctgctgagaacggccaacaggctctttggagagaaaacttgtcagttc
ctctcaacgtttaaggaatcctgtcttcaattctaccatgctgagctgaaggagctttcc
tttatcagagctgcagaagagtccaggaaacacatcaacacctgggtctcaaaaaagacc
gaaggtaaaattgaagagttgttgccgggtagctcaattgatgcagaaaccaggctggtt
cttgtcaatgccatctacttcaaaggaaagtggaatgaaccgtttgacgaaacatacaca
agggaaatgccctttaaaataaaccaggaggagcaaaggccagtgcagatgatgtatcag
gaggccacgtttaagctcgcccacgtgggcgaggtgcgcgcgcagctgctggagctgccc
tacgccaggaaggagctgagcctgctggtgctgctgcctgacgacggcgtggagctcagc
acggtggaaaaaagtctcacttttgagaaactcacagcctggaccaagccagactgtatg
aagagtactgaggttgaagttctccttccaaaatttaaactacaagaggattatgacatg
gaatctgtgcttcggcatttgggaattgttgatgccttccaacagggcaaggctgacttg
tcggcaatgtcagcggagagagacctgtgtctgtccaagttcgtgcacaagagttttgtg
gaggtgaatgaagaaggcaccgaggcagcggcagcgtcgagctgctttgtagttgcagag
tgctgcatggaatctggccccaggttctgtgctgaccaccctttccttttcttcatcagg
cacaacagagccaacagcattctgttctgtggcaggttctcatcgccataa

DBGET integrated database retrieval system