KEGG   Homo sapiens (human): 5275Help
Entry
5275              CDS       T01001                                 

Gene name
SERPINB13, HSHUR7SEQ, HUR7, PI13, headpin
Definition
serpin peptidase inhibitor, clade B (ovalbumin), member 13
Orthology
K13963  
serpin B
Organism
hsa  Homo sapiens (human)
Pathway
Amoebiasis
Class
Human Diseases; Infectious diseases; Amoebiasis [PATH:hsa05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
18q21.33
AA seq 391 aa AA seqDB search
MDSLGAVSTRLGFDLFKELKKTNDGNIFFSPVGILTAIGMVLLGTRGATASQLEEVFHSE
KETKSSRIKAEEKEVIENTEAVHQQFQKFLTEISKLTNDYELNITNRLFGEKTYLFLQKY
LDYVEKYYHASLEPVDFVNAADESRKKINSWVESKTNEKIKDLFPDGSISSSTKLVLVNM
VYFKGQWDREFKKENTKEEKFWMNKSTSKSVQMMTQSHSFSFTFLEDLQAKILGIPYKNN
DLSMFVLLPNDIDGLEKIIDKISPEKLVEWTSPGHMEERKVNLHLPRFEVEDGYDLEAVL
AAMGMGDAFSEHKADYSGMSSGSGLYAQKFLHSSFVAVTEEGTEAAAATGIGFTVTSAPG
HENVHCNHPFLFFIRHNESNSILFFGRFSSP
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggattcacttggcgccgtcagcactcgacttgggtttgatcttttcaaagagctgaag
aaaacaaatgatggcaacatcttcttttcccctgtgggcatcttgactgcaattggcatg
gtcctcctggggacccgaggagccaccgcttcccagttggaggaggtgtttcactctgaa
aaagagacgaagagctcaagaataaaggctgaagaaaaagaggtgattgagaacacagaa
gcagtacatcaacaattccaaaagtttttgactgaaataagcaaactcactaatgattat
gaactgaacataaccaacaggctgtttggagaaaaaacatacctcttccttcaaaaatac
ttagattatgttgaaaaatattatcatgcatctctggaacctgttgattttgtaaatgca
gccgatgaaagtcgaaagaagattaattcctgggttgaaagcaaaacaaatgaaaaaatc
aaggacttgttcccagatggctctattagtagctctaccaagctggtgctggtgaacatg
gtttattttaaagggcaatgggacagggagtttaagaaagaaaatactaaggaagagaaa
ttttggatgaataagagcacaagtaaatctgtacagatgatgacacagagccattccttt
agcttcactttcctggaggacttgcaggccaaaattctagggattccatataaaaacaac
gacctaagcatgtttgtgcttctgcccaacgacatcgatggcctggagaagataatagat
aaaataagtcctgagaaattggtagagtggactagtccagggcatatggaagaaagaaag
gtgaatctgcacttgccccggtttgaggtggaggacggttacgatctagaggcggtcctg
gctgccatggggatgggcgatgccttcagtgagcacaaagccgactactcgggaatgtcg
tcaggctccgggttgtacgcccagaagttcctgcacagttcctttgtggcagtaactgag
gaaggcaccgaggctgcagctgccaccggcataggctttactgtcacatccgccccaggt
catgaaaatgttcactgcaatcatcccttcctgttcttcatcaggcacaatgaatccaac
agcatcctcttcttcggcagattttcttctccttaa

DBGET integrated database retrieval system