KEGG   Homo sapiens (human): 5279Help
Entry
5279              CDS       T01001                                 

Gene name
PIGC, GPI2
Definition
phosphatidylinositol glycan anchor biosynthesis, class C (EC:2.4.1.198)
Orthology
K03859  
phosphatidylinositol glycan, class C
Organism
hsa  Homo sapiens (human)
Pathway
Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
    5279 (PIGC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1q23-q25
AA seq 297 aa AA seqDB search
MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQ
QLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADL
KSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLN
MAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAV
GGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtatgctcaacctgtgactaacaccaaggaggtcaagtggcagaaggtcttgtatgag
cgacagccctttcctgataactatgtggaccggcgattcctggaagagctccggaaaaac
atccatgctcggaaataccaatattgggctgtggtatttgagtccagtgtggtgatccag
cagctgtgcagtgtttgtgtttttgtggttatctggtggtatatggatgagggtcttctg
gccccccattggcttttagggactggtctggcttcttcactgattgggtatgttttgttt
gatctcattgatggaggtgaagggcggaagaagagtgggcagacccggtgggctgacctg
aagagtgccctagtcttcattactttcacttatgggttttcaccagtgctgaagaccctt
acagagtctgtcagcactgacaccatctatgccatgtcagtcttcatgctgttaggccat
ctcatcttttttgactatggtgccaatgctgccattgtatccagcacactatccttgaac
atggccatctttgcttctgtatgcttggcatcacgtcttccccggtccctgcatgccttc
atcatggtgacatttgccattcagatttttgccctgtggcccatgttgcagaagaaacta
aaggcatgtactccccggagctatgtgggggtcacactgctttttgcattttcagccgtg
ggaggcctactgtccattagtgctgtgggagccgtactctttgcccttctgctgatgtct
atctcatgtctgtgtccattctacctcattcgcttgcagctttttaaagaaaacattcat
gggccttgggatgaagctgaaatcaaggaagacttgtccaggttcctcagttaa

DBGET integrated database retrieval system