KEGG   Homo sapiens (human): 529Help
Entry
529               CDS       T01001                                 

Gene name
ATP6V1E1, ATP6E, ATP6E2, ATP6V1E, P31, Vma4
Definition
ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E1 (EC:3.6.3.14)
Orthology
K02150  
V-type H+-transporting ATPase subunit E
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Phagosome
Synaptic vesicle cycle
Collecting duct acid secretion
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    529 (ATP6V1E1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    529 (ATP6V1E1)
 Organismal Systems
  Excretory system
   04966 Collecting duct acid secretion
    529 (ATP6V1E1)
  Nervous system
   04721 Synaptic vesicle cycle
    529 (ATP6V1E1)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    529 (ATP6V1E1)
  Infectious diseases
   05110 Vibrio cholerae infection
    529 (ATP6V1E1)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    529 (ATP6V1E1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.1
AA seq 204 aa AA seqDB search
MALSDADVQKQAEEEFNIEKGRLVQTQRLKIMEYYEKKEKQIEQQKKIQMSNLMNQARLK
VLRARDDLITDLLNEAKQRLSKVVKDTTRYQVLLDGLVLQGLYQLLEPRMIVRCRKQDFP
LVKAAVQKAIPMYKIATKNDVDVQIDQESYLPEDIAGGVEIYNGDRKIKVSNTLESRLDL
IAQQMMPEVRGALFGANANRKFLD
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atggctctcagcgatgctgacgtgcaaaagcaggcagaagaagagttcaacatagagaaa
ggtcggcttgtgcaaacccaaagactaaagattatggaatattatgagaagaaagagaaa
cagattgagcagcagaagaaaattcagatgtccaatttgatgaatcaagcgagactcaaa
gtcctcagagcaagagatgaccttatcacagacctactaaatgaagcaaaacagagactc
agcaaggtggtaaaagatacaaccaggtaccaagtgctgctggatggactggttctccag
ggtttgtaccagttgctggagccccgaatgattgttcgttgcaggaaacaagatttccct
ctggtaaaggctgcagtgcagaaggcaattcctatgtacaaaattgccaccaaaaacgat
gttgatgtccaaattgaccaggagtcctacctgcctgaagacatagctggtggagttgag
atctataatggagatcgtaaaataaaggtttccaacaccctggaaagccggctggatctc
atagcccagcagatgatgccagaagtccggggagccttgtttggtgcaaatgccaacagg
aagtttttggactaa

DBGET integrated database retrieval system