KEGG   Homo sapiens (human): 5292Help
Entry
5292              CDS       T01001                                 

Gene name
PIM1, PIM
Definition
pim-1 oncogene (EC:2.7.11.1)
Orthology
K04702  
proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
MicroRNAs in cancer
Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    5292 (PIM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    5292 (PIM1)
   05221 Acute myeloid leukemia
    5292 (PIM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5292 (PIM1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  PIM family [OT]
   5292 (PIM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.2
AA seq 404 aa AA seqDB search
MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSH
SPRHSLRHSPGSGSCGSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGK
EKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPME
VVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFW
QVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSP
PEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRW
CLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ctgccgcacgagccccacgagccgctcaccccgccgttctcagcgctgcccgaccccgct
ggcgcgccctcccgccgccagtcccggcagcgccctcagttgtcctccgactcgccctcg
gccttccgcgccagccgcagccacagccgcaacgccacccgcagccacagccacagccac
agccccaggcatagccttcggcacagccccggctccggctcctgcggcagctcctctggg
caccgtccctgcgccgacatcctggaggttgggatgctcttgtccaaaatcaactcgctt
gcccacctgcgcgccgcgccctgcaacgacctgcacgccaccaagctggcgcccggcaag
gagaaggagcccctggagtcgcagtaccaggtgggcccgctactgggcagcggcggcttc
ggctcggtctactcaggcatccgcgtctccgacaacttgccggtggccatcaaacacgtg
gagaaggaccggatttccgactggggagagctgcctaatggcactcgagtgcccatggaa
gtggtcctgctgaagaaggtgagctcgggtttctccggcgtcattaggctcctggactgg
ttcgagaggcccgacagtttcgtcctgatcctggagaggcccgagccggtgcaagatctc
ttcgacttcatcacggaaaggggagccctgcaagaggagctggcccgcagcttcttctgg
caggtgctggaggccgtgcggcactgccacaactgcggggtgctccaccgcgacatcaag
gacgaaaacatccttatcgacctcaatcgcggcgagctcaagctcatcgacttcgggtcg
ggggcgctgctcaaggacaccgtctacacggacttcgatgggacccgagtgtatagccct
ccagagtggatccgctaccatcgctaccatggcaggtcggcggcagtctggtccctgggg
atcctgctgtatgatatggtgtgtggagatattcctttcgagcatgacgaagagatcatc
aggggccaggttttcttcaggcagagggtctcttcagaatgtcagcatctcattagatgg
tgcttggccctgagaccatcagataggccaaccttcgaagaaatccagaaccatccatgg
atgcaagatgttctcctgccccaggaaactgctgagatccacctccacagcctgtcgccg
gggcccagcaaatag

DBGET integrated database retrieval system