KEGG   Homo sapiens (human): 5292Help
Entry
5292              CDS       T01001                                 

Gene name
PIM1, PIM
Definition
(RefSeq) Pim-1 proto-oncogene, serine/threonine kinase
  KO
K04702  
proto-oncogene serine/threonine-protein kinase Pim-1 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
Jak-STAT signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Pathways in cancer
MicroRNAs in cancer
Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    5292 (PIM1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    5292 (PIM1)
   05206 MicroRNAs in cancer
    5292 (PIM1)
   05221 Acute myeloid leukemia
    5292 (PIM1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    5292 (PIM1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     5292 (PIM1)
Protein kinases [BR:hsa01001]
 Serine/threonine protein kinases: CAMK group
  PIM family [OT]
   5292 (PIM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
P11309(Tchem)
UniProt: 
Structure
PDB: 

Jmol
Position
6p21.2
AA seq 404 aa AA seqDB search
MPHEPHEPLTPPFSALPDPAGAPSRRQSRQRPQLSSDSPSAFRASRSHSRNATRSHSHSH
SPRHSLRHSPGSGSCGSSSGHRPCADILEVGMLLSKINSLAHLRAAPCNDLHATKLAPGK
EKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPME
VVLLKKVSSGFSGVIRLLDWFERPDSFVLILERPEPVQDLFDFITERGALQEELARSFFW
QVLEAVRHCHNCGVLHRDIKDENILIDLNRGELKLIDFGSGALLKDTVYTDFDGTRVYSP
PEWIRYHRYHGRSAAVWSLGILLYDMVCGDIPFEHDEEIIRGQVFFRQRVSSECQHLIRW
CLALRPSDRPTFEEIQNHPWMQDVLLPQETAEIHLHSLSPGPSK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ctgccgcacgagccccacgagccgctcaccccgccgttctcagcgctgcccgaccccgct
ggcgcgccctcccgccgccagtcccggcagcgccctcagttgtcctccgactcgccctcg
gccttccgcgccagccgcagccacagccgcaacgccacccgcagccacagccacagccac
agccccaggcatagccttcggcacagccccggctccggctcctgcggcagctcctctggg
caccgtccctgcgccgacatcctggaggttgggatgctcttgtccaaaatcaactcgctt
gcccacctgcgcgccgcgccctgcaacgacctgcacgccaccaagctggcgcccggcaag
gagaaggagcccctggagtcgcagtaccaggtgggcccgctactgggcagcggcggcttc
ggctcggtctactcaggcatccgcgtctccgacaacttgccggtggccatcaaacacgtg
gagaaggaccggatttccgactggggagagctgcctaatggcactcgagtgcccatggaa
gtggtcctgctgaagaaggtgagctcgggtttctccggcgtcattaggctcctggactgg
ttcgagaggcccgacagtttcgtcctgatcctggagaggcccgagccggtgcaagatctc
ttcgacttcatcacggaaaggggagccctgcaagaggagctggcccgcagcttcttctgg
caggtgctggaggccgtgcggcactgccacaactgcggggtgctccaccgcgacatcaag
gacgaaaacatccttatcgacctcaatcgcggcgagctcaagctcatcgacttcgggtcg
ggggcgctgctcaaggacaccgtctacacggacttcgatgggacccgagtgtatagccct
ccagagtggatccgctaccatcgctaccatggcaggtcggcggcagtctggtccctgggg
atcctgctgtatgatatggtgtgtggagatattcctttcgagcatgacgaagagatcatc
aggggccaggttttcttcaggcagagggtctcttcagaatgtcagcatctcattagatgg
tgcttggccctgagaccatcagataggccaaccttcgaagaaatccagaaccatccatgg
atgcaagatgttctcctgccccaggaaactgctgagatccacctccacagcctgtcgccg
gggcccagcaaatag

DBGET integrated database retrieval system