KEGG   Homo sapiens (human): 5297Help
Entry
5297              CDS       T01001                                 

Gene name
PI4KA, PI4K-ALPHA, PIK4CA, PMGYCHA, pi4K230
Definition
(RefSeq) phosphatidylinositol 4-kinase alpha (EC:2.7.1.67)
  KO
K00888  
phosphatidylinositol 4-kinase A [EC:2.7.1.67]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5297 (PI4KA)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    5297 (PI4KA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.67  1-phosphatidylinositol 4-kinase
     5297 (PI4KA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
22q11.21
AA seq 2102 aa AA seqDB search
MAAAPARGGGGGGGGGGGCSGSGSSASRGFYFNTVLSLARSLAVQRPASLEKVQKLLCMC
PVDFHGIFQLDERRRDAVIALGIFLIESDLQHKDCVVPYLLRLLKGLPKVYWVEESTARK
GRGALPVAESFSFCLVTLLSDVAYRDPSLRDEILEVLLQVLHVLLGMCQALEIQDKEYLC
KYAIPCLIGISRAFGRYSNMEESLLSKLFPKIPPHSLRVLEELEGVRRRSFNDFRSILPS
NLLTVCQEGTLKRKTSSVSSISQVSPERGMPPPSSPGGSAFHYFEASCLPDGTALEPEYY
FSTISSSFSVSPLFNGVTYKEFNIPLEMLRELLNLVKKIVEEAVLKSLDAIVASVMEANP
SADLYYTSFSDPLYLTMFKMLRDTLYYMKDLPTSFVKEIHDFVLEQFNTSQGELQKILHD
ADRIHNELSPLKLRCQANAACVDLMVWAVKDEQGAENLCIKLSEKLQSKTSSKVIIAHLP
LLICCLQGLGRLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGNDIKISV
TNEHSESTLNVMSGKKSQPSMYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSNRLY
ISQESDKDAHLIPDHTIRALGHIAVALRDTPKVMEPILQILQQKFCQPPSPLDVLIIDQL
GCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDHGYRHCSLAVINALANIAANI
QDEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVLIPVIAVLTRR
LPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEP
LRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLE
YMRVLRSTDPDRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMADKAKTKEN
EEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLS
LSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHL
QEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTLGATQLSERPACVKKDYSNFM
ASLNLRNRYAGEVYGMIRFSGTTGQMSDLNKMMVQDLHSALDRSHPQHYTQAMFKLTAML
ISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKDGVEVPFMREMAGAWHMTV
EQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIF
SSLLQRSMSLNIGGAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYS
TAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKYLTASQLVPPDNQDTRSNLDI
TVGSRQQATQGWINTYPLSSGMSTISKKSGMSKKTNRGSQLHKYYMKRRTLLLSLLATEI
ERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPYLAVQLPA
RFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTG
LSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASKS
QLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLDQLVEEITGSLSGPAKDFYQREFDFFNK
ITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAK
APYLAKFKVKRCGVSELEKEGLRCRSDSEDECSTQEADGQKISWQAAIFKVGDDCRQDML
ALQIIDLFKNIFQLVGLDLFVFPYRVVATAPGCGVIECIPDCTSRDQLGRQTDFGMYDYF
TRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLDKKGHIIHIDFGFMF
ESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTL
MLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSNRSRTYDMIQYYQNDI
PY
NT seq 6309 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccccggcccggggaggcggaggcggaggcggaggcggcggcggctgctcc
ggctccggctccagcgcctcgcggggcttctatttcaacacggtcctgtcactggcccgc
tccctggcggtgcagagaccagcatccttggagaaggtccaaaagcttctttgcatgtgt
ccagtggatttccatgggatcttccagttagatgaaagacggagagatgcagtgattgca
ttgggcatttttctgattgaatctgatcttcagcacaaagattgtgtggttccttacctt
cttcgacttctcaaaggtcttccaaaagtgtattgggtagaagaaagcacagctcggaaa
ggcagaggtgccctcccggttgcagagagcttcagcttctgcttggtaactctgctgtct
gatgtggcctatagggatccttcacttagggatgagattttagaggtgcttttgcaggtt
ttgcatgtcctcttggggatgtgccaggccttggagattcaagacaaagaatacctttgc
aagtatgctatcccatgcctgataggaatctcgcgagcatttgggcgttacagcaacatg
gaagagtctctcctctcaaagctctttcccaaaatccctcctcattccctccgtgtcctg
gaagagcttgaaggtgttcgaaggcgttcctttaatgacttccgctccatcctccccagc
aatctgctgactgtctgtcaggagggtaccctgaagaggaaaaccagcagtgtgtccagc
atctctcaggtcagccctgaacgcggcatgccccctcccagttcccctggaggatctgcc
tttcactactttgaagcctcctgcttgcccgatgggactgccctagagcctgagtactac
ttttcaaccatcagctccagcttctcagtctctccccttttcaacggtgtcacatataag
gagtttaacattccattggaaatgcttcgggaactcttaaacctggtgaagaagatcgtt
gaggaggctgttctcaaatctttggatgccattgtagccagtgtgatggaggccaacccc
agtgctgatctctactacacttccttcagtgaccctctctacctgaccatgttcaagatg
ctgcgtgacactctgtactacatgaaggacctcccgacctcttttgtgaaggagatccat
gattttgtgctggagcagttcaacacgagccagggggagctccagaagattctacatgac
gcagaccggatccacaatgagctgagccccctcaaactgcgctgtcaggcgaatgctgcc
tgtgtggacctcatggtgtgggctgtgaaggacgagcagggtgcagaaaacctttgcatc
aagctatctgagaagctgcagtccaagacgtccagcaaagtcattattgctcacttgccc
ctgctgatctgctgtctgcagggtttgggccgcctgtgcgagaggttcccggtggtggtg
cactctgtgacaccgtccttgcgagacttcctggtcatcccgtccccagttctggtgaag
ctctacaagtaccacagtcagtaccacacagttgctggcaatgatataaaaatcagtgtg
accaatgagcattccgagtcaaccctgaacgtcatgtcgggtaagaagagccagccctcc
atgtacgagcagctccgagacatcgctattgacaacatctgcaggtgcctgaaggctgga
ttgacggtggacccagtgattgtggaggcgttcttggccagcctgtccaaccggctctac
atctctcaggagagcgacaaggacgctcacttgattcccgaccacacaatccgagccttg
ggacacattgcggtggccttgagggacaccccgaaggtcatggagcccattctgcagatc
ctacagcagaaattctgccagccaccctcccccctcgatgtgctgattattgaccagctg
ggctgcctggttatcaccggaaatcaatacatctatcaggaagtgtggaacctcttccag
cagatcagtgtgaaggccagctccgttgtatactcagccaccaaagattacaaggaccac
ggctataggcattgctccctggcagtgattaatgccctggccaacatcgcggccaacatc
caagacgagcacctggtggatgagctgctcatgaacctgttggagttgtttgtgcagctg
gggctggaggggaagcgagccagcgagagggcaagcgagaagggccctgccctaaaggct
tctagcagtgcagggaacttgggagtactcattcctgtaatagctgtgctcacccgacga
ctgccacccatcaaagaagctaagcctcggttacagaagctcttccgagacttctggctg
tattccgttctgatgggattcgctgtggagggctcaggactctggccagaagaatggtac
gagggggtctgtgaaatagccactaagtcccccttgctcacctttcccagcaaggagcca
ctgcggtccgtcctccagtataactcagccatgaagaatgacacggtcacccccgctgag
ctgagtgagctccgcagcactatcatcaacctgctggacccccctcccgaggtgtccgca
ctcatcaacaagctggacttcgccatgtccacctacctcctctctgtgtaccggctggag
tacatgagggtactgcgttcaacagatcctgatcgcttccaggtaatgttctgctacttt
gaggataaagctattcagaaagacaaatctgggatgatgcagtgtgtgattgcagtcgcg
gacaaagtattcgatgccttcctgaacatgatggcggataaagccaagaccaaggagaac
gaggaggagctggagcggcacgctcagttcctgttggtgaacttcaaccacatccacaag
aggataaggagggtggcagacaagtatctatctggtctggtggataagtttccccacttg
ctctggagcgggactgtgctgaagaccatgctggacatcctgcagaccctgtcactgtca
ctgagcgctgatattcacaaggatcagccttactatgacatccccgacgccccctaccgg
atcacggttcctgacacgtacgaagcccgtgagagcattgtgaaggacttcgctgcacgc
tgtgggatgatcctccaggaggccatgaagtgggcacctaccgtcaccaagtcccacctg
caggaatatctgaacaaacatcagaactgggtatcgggactgtcccagcacacggggctg
gccatggccactgagagcatccttcactttgctggctacaacaagcagaacacaactctt
ggggcaactcagctgagcgagcgcccggcctgtgtgaagaaagactactccaacttcatg
gcatccctgaatctgcgcaaccgctacgcgggcgaggtgtatggaatgattcggttctca
ggcaccacaggccagatgtctgacctgaacaaaatgatggtccaggatctacattcagct
ttagaccgcagtcatcctcagcactacacgcaggccatgttcaagctgaccgcaatgctc
attagcagtaaagattgtgacccgcagctccttcatcatctgtgctggggtcccctccgg
atgttcaatgagcatggcatggagacggccctggcctgctgggagtggctgctggctggc
aaggatggagtggaagtgccgttcatgcgggagatggcaggggcctggcacatgacggtg
gagcagaaatttggcctgttttctgctgagataaaggaagcagaccccctggctgcctcg
gaagcaagtcaacccaaaccctgtccccccgaagtgaccccccactacatctggatcgac
ttcctggtgcagcggtttgagatcgccaagtactgcagctctgaccaagtggagatcttc
tccagcctgctgcagcgctccatgtccctgaacatcggcggggccaaggggagcatgaac
cggcacgtggcggccatcgggccccgcttcaagctgctgaccctggggctgtccctcctg
catgccgatgtggttccaaatgcaaccatccgcaatgtgcttcgcgagaagatctactcc
actgcctttgactacttcagctgtcccccaaagttccctactcaaggagagaagcggctg
cgtgaagacataagcatcatgattaaattttggaccgccatgttctcagataagaagtac
ctgaccgccagccagcttgttcccccagataatcaggacacccggagcaacctggacata
actgtcggctctcggcaacaagccacccaaggctggatcaacacataccccctgtccagc
ggcatgtccaccatctccaagaaatcaggcatgtctaagaaaaccaaccggggctcccag
ctgcacaaatactacatgaagcgcaggacgctgctgctgtccctgctggccactgagatc
gagcgtctcatcacatggtacaacccgctgtcagccccggaactggaactagaccaggcc
ggagagaacagcgtggccaactggagatctaagtacatcagcctgagtgagaagcagtgg
aaggacaacgtgaacctcgcctggagcatctctccctacctagccgtgcagctgcctgcc
aggtttaagaacacagaagccattgggaacgaagtgacccgtctcgttcggttggacccg
ggagccgttagtgatgtgcctgaagcaatcaagttcctggtcacctggcacaccatcgac
gccgatgctccagagctcagccatgtgctgtgctgggcgcccacggacccacccacaggc
ctctcctacttctccagcatgtacccgccgcaccctctcacggcgcagtacggggtgaaa
gtcctgcggtccttccctccggacgccatcctcttctacatcccccagattgtgcaggcc
ctcaggtacgacaagatgggctatgtgcgggagtatattctgtgggcagcgtctaaatcc
cagcttctggcacaccagttcatctggaacatgaagactaacatttatctagatgaagag
ggccaccagaaagaccctgacatcggcgacctcctggatcagttggtagaggagatcaca
ggctccttgtccggcccagcgaaggacttttaccagcgggagtttgatttctttaacaag
atcaccaacgtgtcggctatcatcaagccctaccctaaaggcgacgagagaaagaaggct
tgtctgtcggccctgtctgaagtgaaggtgcagccgggctgctacctgcccagcaaccct
gaggccattgtgctggacatcgactacaagtctgggaccccgatgcagagtgctgcaaaa
gccccatatctggccaagttcaaggtgaagcgatgtggagttagtgaacttgaaaaagaa
ggtctgcggtgccgctcagactccgaggatgagtgcagcacgcaggaggccgacggccag
aagatctcctggcaggcagccatcttcaaggtgggagacgactgccggcaggacatgctg
gccctgcagatcatcgacctcttcaagaacatcttccagctggtcggcctggacctcttt
gtttttccctaccgcgtggtggccactgcccctgggtgcggggtgatcgagtgcatcccc
gactgcacctcccgggaccagctgggccgccagacagacttcggcatgtacgactacttc
acacgccagtacggggatgagtccactctggccttccagcaggcccgctacaacttcatc
cgaagcatggccgcctacagcctcctgctgttcctgctgcagatcaaggacagacacaac
ggcaacattatgctggacaagaagggtcatatcatccacatcgactttggcttcatgttt
gaaagctcgccgggcggcaatctcggctgggaacccgacatcaagctgacggatgagatg
gtgatgatcatggggggcaagatggaggccacacccttcaagtggttcatggagatgtgt
gtccgaggctacctggctgtgcggccctacatggacgcggtcgtctccctggtcactctc
atgttggacacgggcctgccctgttttcgcggccagacaatcaagctcttgaagcacagg
tttagccccaacatgactgagcgcgaggctgcaaatttcatcatgaaggtcatccagagc
tgcttcctcagcaacaggagccggacctacgacatgatccagtactatcagaatgacatc
ccctactga

DBGET integrated database retrieval system