KEGG   Homo sapiens (human): 5300Help
Entry
5300              CDS       T01001                                 

Gene name
PIN1, DOD, UBL5
Definition
peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (EC:5.2.1.8)
Orthology
K09578  
peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04622 RIG-I-like receptor signaling pathway
    5300 (PIN1)
Enzymes [BR:hsa01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     5300 (PIN1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     5300 (PIN1)
Chaperones and folding catalysts [BR:hsa03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    5300 (PIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13
AA seq 163 aa AA seqDB search
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggagaagctgccgcccggctgggagaagcgcatgagccgcagctcaggc
cgagtgtactacttcaaccacatcactaacgccagccagtgggagcggcccagcggcaac
agcagcagtggtggcaaaaacgggcagggggagcctgccagggtccgctgctcgcacctg
ctggtgaagcacagccagtcacggcggccctcgtcctggcggcaggagaagatcacccgg
accaaggaggaggccctggagctgatcaacggctacatccagaagatcaagtcgggagag
gaggactttgagtctctggcctcacagttcagcgactgcagctcagccaaggccagggga
gacctgggtgccttcagcagaggtcagatgcagaagccatttgaagacgcctcgtttgcg
ctgcggacgggggagatgagcgggcccgtgttcacggattccggcatccacatcatcctc
cgcactgagtga

DBGET integrated database retrieval system