KEGG   Homo sapiens (human): 5300Help
Entry
5300              CDS       T01001                                 

Gene name
PIN1, DOD, UBL5
Definition
peptidylprolyl cis/trans isomerase, NIMA-interacting 1 (EC:5.2.1.8)
Orthology
K09578  
peptidyl-prolyl cis-trans isomerase NIMA-interacting 1 [EC:5.2.1.8]
Organism
hsa  Homo sapiens (human)
Pathway
RIG-I-like receptor signaling pathway
Class
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:hsa04622]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19p13
AA seq 163 aa AA seqDB search
MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHL
LVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARG
DLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaggagaagctgccgcccggctgggagaagcgcatgagccgcagctcaggc
cgagtgtactacttcaaccacatcactaacgccagccagtgggagcggcccagcggcaac
agcagcagtggtggcaaaaacgggcagggggagcctgccagggtccgctgctcgcacctg
ctggtgaagcacagccagtcacggcggccctcgtcctggcggcaggagaagatcacccgg
accaaggaggaggccctggagctgatcaacggctacatccagaagatcaagtcgggagag
gaggactttgagtctctggcctcacagttcagcgactgcagctcagccaaggccagggga
gacctgggtgccttcagcagaggtcagatgcagaagccatttgaagacgcctcgtttgcg
ctgcggacgggggagatgagcgggcccgtgttcacggattccggcatccacatcatcctc
cgcactgagtga

DBGET integrated database retrieval system