KEGG   Homo sapiens (human): 5305Help
Entry
5305              CDS       T01001                                 

Gene name
PIP4K2A, PI5P4KA, PIP5K2A, PIP5KII-alpha, PIP5KIIA, PIPK
Definition
phosphatidylinositol-5-phosphate 4-kinase, type II, alpha (EC:2.7.1.149)
Orthology
K00920  
1-phosphatidylinositol-5-phosphate 4-kinase [EC:2.7.1.149]
Organism
hsa  Homo sapiens (human)
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5305 (PIP4K2A)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    5305 (PIP4K2A)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    5305 (PIP4K2A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.149  1-phosphatidylinositol-5-phosphate 4-kinase
     5305 (PIP4K2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10p12.2
AA seq 406 aa AA seqDB search
MATPGNLGSSVLASKTKTKKKHFVAQKVKLFRASDPLLSVLMWGVNHSINELSHVQIPVM
LMPDDFKAYSKIKVDNHLFNKENMPSHFKFKEYCPMVFRNLRERFGIDDQDFQNSLTRSA
PLPNDSQARSGARFHTSYDKRYIIKTITSEDVAEMHNILKKYHQYIVECHGITLLPQFLG
MYRLNVDGVEIYVIVTRNVFSHRLSVYRKYDLKGSTVAREASDKEKAKELPTLKDNDFIN
EGQKIYIDDNNKKVFLEKLKKDVEFLAQLKLMDYSLLVGIHDVERAEQEEVECEENDGEE
EGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDVYGIKCHENSPRKEVYFMAIIDI
LTHYDAKKKAAHAAKTVKHGAGAEISTVNPEQYSKRFLDFIGHILT
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccccggcaacctagggtcctctgtcctggcgagcaagaccaagaccaagaag
aagcacttcgtagcgcagaaagtgaagctgtttcgggccagcgacccgctgctcagcgtc
ctcatgtggggggtaaaccactcgatcaatgaactgagccatgttcaaatccctgttatg
ttgatgccagatgacttcaaagcctattcaaaaataaaggtggacaatcacctttttaac
aaagaaaacatgccgagccatttcaagtttaaggaatactgcccgatggtcttccgtaac
ctgcgggagaggtttggaattgatgatcaagatttccagaattccctgaccaggagcgca
cccctccccaacgactcccaggcccgcagtggagctcgttttcacacttcctacgacaaa
agatacatcatcaagactattaccagtgaagacgtggccgaaatgcacaacatcctgaag
aaataccaccagtacatagtggaatgtcatgggatcacccttcttccccagttcttgggc
atgtaccggcttaatgttgatggagttgaaatatatgtgatagttacaagaaatgtattc
agccaccgtttgtctgtgtataggaaatacgacttaaagggctctacagtggctagagaa
gctagtgacaaagaaaaggccaaagaactgccaactctgaaagataatgatttcattaat
gagggccaaaagatttatattgatgacaacaacaagaaggtcttcctggaaaaactaaaa
aaggatgttgagtttctggcccagctgaagctcatggactacagtctgctggtgggaatt
catgatgtggagagagccgaacaggaggaagtggagtgtgaggagaacgatggggaggag
gagggcgagagcgatggcacccacccggtgggaacccccccagatagccccgggaataca
ctgaacagctcaccacccctggctcccggggagttcgatccgaacatcgacgtctatgga
attaagtgccatgaaaactcgcctaggaaggaggtgtacttcatggcaattattgacatc
cttactcattatgatgcaaaaaagaaagctgcccatgctgcaaaaactgttaaacatggc
gctggcgcggagatctccaccgtgaacccagaacagtattcaaagcgctttttggacttt
attggccacatcttgacgtaa

DBGET integrated database retrieval system