KEGG   Homo sapiens (human): 5310Help
Entry
5310              CDS       T01001                                 

Gene name
PKD1, PBP, Pc-1, TRPP1
Definition
(RefSeq) polycystin 1, transient receptor potential channel interacting
  KO
K04985  
polycystin 1
Organism
hsa  Homo sapiens (human)
Disease
H00542  
Polycystic kidney disease
Brite
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filament-binding proteins
    5310 (PKD1)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPP (Polycystin)
   5310 (PKD1)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 10: Polycystin
   5310 (PKD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
16p13.3
AA seq 4303 aa AA seqDB search
MPPAAPARLALALGLGLWLGALAGGPGRGCGPCEPPCLCGPAPGAACRVNCSGRGLRTLG
PALRIPADATALDVSHNLLRALDVGLLANLSALAELDISNNKISTLEEGIFANLFNLSEI
NLSGNPFECDCGLAWLPRWAEEQQVRVVQPEAATCAGPGSLAGQPLLGIPLLDSGCGEEY
VACLPDNSSGTVAAVSFSAAHEGLLQPEACSAFCFSTGQGLAALSEQGWCLCGAAQPSSA
SFACLSLCSGPPPPPAPTCRGPTLLQHVFPASPGATLVGPHGPLASGQLAAFHIAAPLPV
TATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEAAPAALE
LVCPSSVQSDESLDLSIQNRGGSGLEAAYSIVALGEEPARAVHPLCPSDTEIFPGNGHCY
RLVVEKAAWLQAQEQCQAWAGAALAMVDSPAVQRFLVSRVTRSLDVWIGFSTVQGVEVGP
APQGEAFSLESCQNWLPGEPHPATAEHCVRLGPTGWCNTDLCSAPHSYVCELQPGGPVQD
AENLLVGAPSGDLQGPLTPLAQQDGLSAPHEPVEVMVFPGLRLSREAFLTTAEFGTQELR
RPAQLRLQVYRLLSTAGTPENGSEPESRSPDNRTQLAPACMPGGRWCPGANICLPLDASC
HPQACANGCTSGPGLPGAPYALWREFLFSVPAGPPAQYSVTLHGQDVLMLPGDLVGLQHD
AGPGALLHCSPAPGHPGPQAPYLSANASSWLPHLPAQLEGTWACPACALRLLAATEQLTV
LLGLRPNPGLRLPGRYEVRAEVGNGVSRHNLSCSFDVVSPVAGLRVIYPAPRDGRLYVPT
NGSALVLQVDSGANATATARWPGGSVSARFENVCPALVATFVPGCPWETNDTLFSVVALP
WLSEGEHVVDVVVENSASRANLSLRVTAEEPICGLRATPSPEARVLQGVLVRYSPVVEAG
SDMVFRWTINDKQSLTFQNVVFNVIYQSAAVFKLSLTASNHVSNVTVNYNVTVERMNRMQ
GLQVSTVPAVLSPNATLALTAGVLVDSAVEVAFLWTFGDGEQALHQFQPPYNESFPVPDP
SVAQVLVEHNVMHTYAAPGEYLLTVLASNAFENLTQQVPVSVRASLPSVAVGVSDGVLVA
GRPVTFYPHPLPSPGGVLYTWDFGDGSPVLTQSQPAANHTYASRGTYHVRLEVNNTVSGA
AAQADVRVFEELRGLSVDMSLAVEQGAPVVVSAAVQTGDNITWTFDMGDGTVLSGPEATV
EHVYLRAQNCTVTVGAASPAGHLARSLHVLVFVLEVLRVEPAACIPTQPDARLTAYVTGN
PAHYLFDWTFGDGSSNTTVRGCPTVTHNFTRSGTFPLALVLSSRVNRAHYFTSICVEPEV
GNVTLQPERQFVQLGDEAWLVACAWPPFPYRYTWDFGTEEAAPTRARGPEVTFIYRDPGS
YLVTVTASNNISAANDSALVEVQEPVLVTSIKVNGSLGLELQQPYLFSAVGRGRPASYLW
DLGDGGWLEGPEVTHAYNSTGDFTVRVAGWNEVSRSEAWLNVTVKRRVRGLVVNASRTVV
PLNGSVSFSTSLEAGSDVRYSWVLCDRCTPIPGGPTISYTFRSVGTFNIIVTAENEVGSA
QDSIFVYVLQLIEGLQVVGGGRYFPTNHTVQLQAVVRDGTNVSYSWTAWRDRGPALAGSG
KGFSLTVLEAGTYHVQLRATNMLGSAWADCTMDFVEPVGWLMVAASPNPAAVNTSVTLSA
ELAGGSGVVYTWSLEEGLSWETSEPFTTHSFPTPGLHLVTMTAGNPLGSANATVEVDVQV
PVSGLSIRASEPGGSFVAAGSSVPFWGQLATGTNVSWCWAVPGGSSKRGPHVTMVFPDAG
TFSIRLNASNAVSWVSATYNLTAEEPIVGLVLWASSKVVAPGQLVHFQILLAAGSAVTFR
LQVGGANPEVLPGPRFSHSFPRVGDHVVSVRGKNHVSWAQAQVRIVVLEAVSGLQVPNCC
EPGIATGTERNFTARVQRGSRVAYAWYFSLQKVQGDSLVILSGRDVTYTPVAAGLLEIQV
RAFNALGSENRTLVLEVQDAVQYVALQSGPCFTNRSAQFEAATSPSPRRVAYHWDFGDGS
PGQDTDEPRAEHSYLRPGDYRVQVNASNLVSFFVAQATVTVQVLACREPEVDVVLPLQVL
MRRSQRNYLEAHVDLRDCVTYQTEYRWEVYRTASCQRPGRPARVALPGVDVSRPRLVLPR
LALPVGHYCFVFVVSFGDTPLTQSIQANVTVAPERLVPIIEGGSYRVWSDTRDLVLDGSE
SYDPNLEDGDQTPLSFHWACVASTQREAGGCALNFGPRGSSTVTIPRERLAAGVEYTFSL
TVWKAGRKEEATNQTVLIRSGRVPIVSLECVSCKAQAVYEVSRSSYVYLEGRCLNCSSGS
KRGRWAARTFSNKTLVLDETTTSTGSAGMRLVLRRGVLRDGEGYTFTLTVLGRSGEEEGC
ASIRLSPNRPPLGGSCRLFPLGAVHALTTKVHFECTGWHDAEDAGAPLVYALLLRRCRQG
HCEEFCVYKGSLSSYGAVLPPGFRPHFEVGLAVVVQDQLGAAVVALNRSLAITLPEPNGS
ATGLTVWLHGLTASVLPGLLRQADPQHVIEYSLALVTVLNEYERALDVAAEPKHERQHRA
QIRKNITETLVSLRVHTVDDIQQIAAALAQCMGPSRELVCRSCLKQTLHKLEAMMLILQA
ETTAGTVTPTAIGDSILNITGDLIHLASSDVRAPQPSELGAESPSRMVASQAYNLTSALM
RILMRSRVLNEEPLTLAGEEIVAQGKRSDPRSLLCYGGAPGPGCHFSIPEAFSGALANLS
DVVQLIFLVDSNPFPFGYISNYTVSTKVASMAFQTQAGAQIPIERLASERAITVKVPNNS
DWAARGHRSSANSANSVVVQPQASVGAVVTLDSSNPAAGLHLQLNYTLLDGHYLSEEPEP
YLAVYLHSEPRPNEHNCSASRRIRPESLQGADHRPYTFFISPGSRDPAGSYHLNLSSHFR
WSALQVSVGLYTSLCQYFSEEDMVWRTEGLLPLEETSPRQAVCLTRHLTAFGASLFVPPS
HVRFVFPEPTADVNYIVMLTCAVCLVTYMVMAAILHKLDQLDASRGRAIPFCGQRGRFKY
EILVKTGWGRGSGTTAHVGIMLYGVDSRSGHRHLDGDRAFHRNSLDIFRIATPHSLGSVW
KIRVWHDNKGLSPAWFLQHVIVRDLQTARSAFFLVNDWLSVETEANGGLVEKEVLAASDA
ALLRFRRLLVAELQRGFFDKHIWLSIWDRPPRSRFTRIQRATCCVLLICLFLGANAVWYG
AVGDSAYSTGHVSRLSPLSVDTVAVGLVSSVVVYPVYLAILFLFRMSRSKVAGSPSPTPA
GQQVLDIDSCLDSSVLDSSFLTFSGLHAEQAFVGQMKSDLFLDDSKSLVCWPSGEGTLSW
PDLLSDPSIVGSNLRQLARGQAGHGLGPEEDGFSLASPYSPAKSFSASDEDLIQQVLAEG
VSSPAPTQDTHMETDLLSSLSSTPGEKTETLALQRLGELGPPSPGLNWEQPQAARLSRTG
LVEGLRKRLLPAWCASLAHGLSLLLVAVAVAVSGWVGASFPPGVSVAWLLSSSASFLASF
LGWEPLKVLLEALYFSLVAKRLHPDEDDTLVESPAVTPVSARVPRVRPPHGFALFLAKEE
ARKVKRLHGMLRSLLVYMLFLLVTLLASYGDASCHGHAYRLQSAIKQELHSRAFLAITRS
EELWPWMAHVLLPYVHGNQSSPELGPPRLRQVRLQEALYPDPPGPRVHTCSAAGGFSTSD
YDVGWESPHNGSGTWAYSAPDLLGAWSWGSCAVYDSGGYVQELGLSLEESRDRLRFLQLH
NWLDNRSRAVFLELTRYSPAVGLHAAVTLRLEFPAAGRALAALSVRPFALRRLSAGLSLP
LLTSVCLLLFAVHFAVAEARTWHREGRWRVLRLGAWARWLLVALTAATALVRLAQLGAAD
RQWTRFVRGRPRRFTSFDQVAQLSSAARGLAASLLFLLLVKAAQQLRFVRQWSVFGKTLC
RALPELLGVTLGLVVLGVAYAQLAILLVSSCVDSLWSVAQALLVLCPGTGLSTLCPAESW
HLSPLLCVGLWALRLWGALRLGAVILRWRYHALRGELYRPAWEPQDYEMVELFLRRLRLW
MGLSKVKEFRHKVRFEGMEPLPSRSSRGSKVSPDVPPPSAGSDASHPSTSSSQLDGLSVS
LGRLGTRCEPEPSRLQAVFEALLTQFDRLNQATEDVYQLEQQLHSLQGRRSSRAPAGSSR
GPSPGLRPALPSRLARASRGVDLATGPSRTPLRAKNKVHPSST
NT seq 12912 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgccgcgcccgcccgcctggcgctggccctgggcctgggcctgtggctcggg
gcgctggcggggggccccgggcgcggctgcgggccctgcgagcccccctgcctctgcggc
ccagcgcccggcgccgcctgccgcgtcaactgctcgggccgcgggctgcggacgctcggt
cccgcgctgcgcatccccgcggacgccacagcgctagacgtctcccacaacctgctccgg
gcgctggacgttgggctcctggcgaacctctcggcgctggcagagctggatataagcaac
aacaagatttctacgttagaagaaggaatatttgctaatttatttaatttaagtgaaata
aacctgagtgggaacccgtttgagtgtgactgtggcctggcgtggctgccgcgatgggcg
gaggagcagcaggtgcgggtggtgcagcccgaggcagccacgtgtgctgggcctggctcc
ctggctggccagcctctgcttggcatccccttgctggacagtggctgtggtgaggagtat
gtcgcctgcctccctgacaacagctcaggcaccgtggcagcagtgtccttttcagctgcc
cacgaaggcctgcttcagccagaggcctgcagcgccttctgcttctccaccggccagggc
ctcgcagccctctcggagcagggctggtgcctgtgtggggcggcccagccctccagtgcc
tcctttgcctgcctgtccctctgctccggccccccgccacctcctgcccccacctgtagg
ggccccaccctcctccagcacgtcttccctgcctccccaggggccaccctggtggggccc
cacggacctctggcctctggccagctagcagccttccacatcgctgccccgctccctgtc
actgccacacgctgggacttcggagacggctccgccgaggtggatgccgctgggccggct
gcctcgcatcgctatgtgctgcctgggcgctatcacgtgacggccgtgctggccctgggg
gccggctcagccctgctggggacagacgtgcaggtggaagcggcacctgccgccctggag
ctcgtgtgcccgtcctcggtgcagagtgacgagagccttgacctcagcatccagaaccgc
ggtggttcaggcctggaggccgcctacagcatcgtggccctgggcgaggagccggcccga
gcggtgcacccgctctgcccctcggacacggagatcttccctggcaacgggcactgctac
cgcctggtggtggagaaggcggcctggctgcaggcgcaggagcagtgtcaggcctgggcc
ggggccgccctggcaatggtggacagtcccgccgtgcagcgcttcctggtctcccgggtc
accaggagcctagacgtgtggatcggcttctcgactgtgcagggggtggaggtgggccca
gcgccgcagggcgaggccttcagcctggagagctgccagaactggctgcccggggagcca
cacccagccacagccgagcactgcgtccggctcgggcccaccgggtggtgtaacaccgac
ctgtgctcagcgccgcacagctacgtctgcgagctgcagcccggaggcccagtgcaggat
gccgagaacctcctcgtgggagcgcccagtggggacctgcagggacccctgacgcctctg
gcacagcaggacggcctctcagccccgcacgagcccgtggaggtcatggtattcccgggc
ctgcgtctgagccgtgaagccttcctcaccacggccgaatttgggacccaggagctccgg
cggcccgcccagctgcggctgcaggtgtaccggctcctcagcacagcagggaccccggag
aacggcagcgagcctgagagcaggtccccggacaacaggacccagctggcccccgcgtgc
atgccagggggacgctggtgccctggagccaacatctgcttgccgctggacgcctcctgc
cacccccaggcctgcgccaatggctgcacgtcagggccagggctacccggggccccctat
gcgctatggagagagttcctcttctccgttcccgcggggccccccgcgcagtactcggtc
accctccacggccaggatgtcctcatgctccctggtgacctcgttggcttgcagcacgac
gctggccctggcgccctcctgcactgctcgccggctcccggccaccctggtccccaggcc
ccgtacctctccgccaacgcctcgtcatggctgccccacttgccagcccagctggagggc
acttgggcctgccctgcctgtgccctgcggctgcttgcagccacggaacagctcaccgtg
ctgctgggcttgaggcccaaccctggactgcggctgcctgggcgctatgaggtccgggca
gaggtgggcaatggcgtgtccaggcacaacctctcctgcagctttgacgtggtctcccca
gtggctgggctgcgggtcatctaccctgccccccgcgacggccgcctctacgtgcccacc
aacggctcagccttggtgctccaggtggactctggtgccaacgccacggccacggctcgc
tggcctgggggcagtgtcagcgcccgctttgagaatgtctgccctgccctggtggccacc
ttcgtgcccggctgcccctgggagaccaacgataccctgttctcagtggtagcactgccg
tggctcagtgagggggagcacgtggtggacgtggtggtggaaaacagcgccagccgggcc
aacctcagcctgcgggtgacggcggaggagcccatctgtggcctccgcgccacgcccagc
cccgaggcccgtgtactgcagggagtcctagtgaggtacagccccgtggtggaggccggc
tcggacatggtcttccggtggaccatcaacgacaagcagtccctgaccttccagaacgtg
gtcttcaatgtcatttatcagagcgcggcggtcttcaagctctcactgacggcctccaac
cacgtgagcaacgtcaccgtgaactacaacgtaaccgtggagcggatgaacaggatgcag
ggtctgcaggtctccacagtgccggccgtgctgtcccccaatgccacgctagcactgacg
gcgggcgtgctggtggactcggccgtggaggtggccttcctgtggacctttggggatggg
gagcaggccctccaccagttccagcctccgtacaacgagtccttcccggttccagacccc
tcggtggcccaggtgctggtggagcacaatgtcatgcacacctacgctgccccaggtgag
tacctcctgaccgtgctggcatctaatgccttcgagaacctgacgcagcaggtgcctgtg
agcgtgcgcgcctccctgccctccgtggctgtgggtgtgagtgacggcgtcctggtggcc
ggccggcccgtcaccttctacccgcacccgctgccctcgcctgggggtgttctttacacg
tgggacttcggggacggctcccctgtcctgacccagagccagccggctgccaaccacacc
tatgcctcgaggggcacctaccacgtgcgcctggaggtcaacaacacggtgagcggtgcg
gcggcccaggcggatgtgcgcgtctttgaggagctccgcggactcagcgtggacatgagc
ctggccgtggagcagggcgcccccgtggtggtcagcgccgcggtgcagacgggcgacaac
atcacgtggaccttcgacatgggggacggcaccgtgctgtcgggcccggaggcaacagtg
gagcatgtgtacctgcgggcacagaactgcacagtgaccgtgggtgcggccagccccgcc
ggccacctggcccggagcctgcacgtgctggtcttcgtcctggaggtgctgcgcgttgaa
cccgccgcctgcatccccacgcagcctgacgcgcggctcacggcctacgtcaccgggaac
ccggcccactacctcttcgactggaccttcggggatggctcctccaacacgaccgtgcgg
gggtgcccgacggtgacacacaacttcacgcggagcggcacgttccccctggcgctggtg
ctgtccagccgcgtgaacagggcgcattacttcaccagcatctgcgtggagccagaggtg
ggcaacgtcaccctgcagccagagaggcagtttgtgcagctcggggacgaggcctggctg
gtggcatgtgcctggcccccgttcccctaccgctacacctgggactttggcaccgaggaa
gccgcccccacccgtgccaggggccctgaggtgacgttcatctaccgagacccaggctcc
tatcttgtgacagtcaccgcgtccaacaacatctctgctgccaatgactcagccctggtg
gaggtgcaggagcccgtgctggtcaccagcatcaaggtcaatggctcccttgggctggag
ctgcagcagccgtacctgttctctgctgtgggccgtgggcgccccgccagctacctgtgg
gatctgggggacggtgggtggctcgagggtccggaggtcacccacgcttacaacagcaca
ggtgacttcaccgttagggtggccggctggaatgaggtgagccgcagcgaggcctggctc
aatgtgacggtgaagcggcgcgtgcgggggctcgtcgtcaatgcaagccgcacggtggtg
cccctgaatgggagcgtgagcttcagcacgtcgctggaggccggcagtgatgtgcgctat
tcctgggtgctctgtgaccgctgcacgcccatccctgggggtcctaccatctcttacacc
ttccgctccgtgggcaccttcaatatcatcgtcacggctgagaacgaggtgggctccgcc
caggacagcatcttcgtctatgtcctgcagctcatagaggggctgcaggtggtgggcggt
ggccgctacttccccaccaaccacacggtacagctgcaggccgtggttagggatggcacc
aacgtctcctacagctggactgcctggagggacaggggcccggccctggccggcagcggc
aaaggcttctcgctcaccgtgctcgaggccggcacctaccatgtgcagctgcgggccacc
aacatgctgggcagcgcctgggccgactgcaccatggacttcgtggagcctgtggggtgg
ctgatggtggccgcctccccgaacccagctgccgtcaacacaagcgtcaccctcagtgcc
gagctggctggtggcagtggtgtcgtatacacttggtccttggaggaggggctgagctgg
gagacctccgagccatttaccacccatagcttccccacacccggcctgcacttggtcacc
atgacggcagggaacccgctgggctcagccaacgccaccgtggaagtggatgtgcaggtg
cctgtgagtggcctcagcatcagggccagcgagcccggaggcagcttcgtggcggccggg
tcctctgtgcccttttgggggcagctggccacgggcaccaatgtgagctggtgctgggct
gtgcccggcggcagcagcaagcgtggccctcatgtcaccatggtcttcccggatgctggc
accttctccatccggctcaatgcctccaacgcagtcagctgggtctcagccacgtacaac
ctcacggcggaggagcccatcgtgggcctggtgctgtgggccagcagcaaggtggtggcg
cccgggcagctggtccattttcagatcctgctggctgccggctcagctgtcaccttccgc
ctgcaggtcggcggggccaaccccgaggtgctccccgggccccgtttctcccacagcttc
ccccgcgtcggagaccacgtggtgagcgtgcggggcaaaaaccacgtgagctgggcccag
gcgcaggtgcgcatcgtggtgctggaggccgtgagtgggctgcaggtgcccaactgctgc
gagcctggcatcgccacgggcactgagaggaacttcacagcccgcgtgcagcgcggctct
cgggtcgcctacgcctggtacttctcgctgcagaaggtccagggcgactcgctggtcatc
ctgtcgggccgcgacgtcacctacacgcccgtggccgcggggctgttggagatccaggtg
cgcgccttcaacgccctgggcagtgagaaccgcacgctggtgctggaggttcaggacgcc
gtccagtatgtggccctgcagagcggcccctgcttcaccaaccgctcggcgcagtttgag
gccgccaccagccccagcccccggcgtgtggcctaccactgggactttggggatgggtcg
ccagggcaggacacagatgagcccagggccgagcactcctacctgaggcctggggactac
cgcgtgcaggtgaacgcctccaacctggtgagcttcttcgtggcgcaggccacggtgacc
gtccaggtgctggcctgccgggagccggaggtggacgtggtcctgcccctgcaggtgctg
atgcggcgatcacagcgcaactacttggaggcccacgttgacctgcgcgactgcgtcacc
taccagactgagtaccgctgggaggtgtatcgcaccgccagctgccagcggccggggcgc
ccagcgcgtgtggccctgcccggcgtggacgtgagccggcctcggctggtgctgccgcgg
ctggcgctgcctgtggggcactactgctttgtgtttgtcgtgtcatttggggacacgcca
ctgacacagagcatccaggccaatgtgacggtggcccccgagcgcctggtgcccatcatt
gagggtggctcataccgcgtgtggtcagacacacgggacctggtgctggatgggagcgag
tcctacgaccccaacctggaggacggcgaccagacgccgctcagtttccactgggcctgt
gtggcttcgacacagagggaggctggcgggtgtgcgctgaactttgggccccgcgggagc
agcacggtcaccattccacgggagcggctggcggctggcgtggagtacaccttcagcctg
accgtgtggaaggccggccgcaaggaggaggccaccaaccagacggtgctgatccggagt
ggccgggtgcccattgtgtccttggagtgtgtgtcctgcaaggcacaggccgtgtacgaa
gtgagccgcagctcctacgtgtacttggagggccgctgcctcaattgcagcagcggctcc
aagcgagggcggtgggctgcacgtacgttcagcaacaagacgctggtgctggatgagacc
accacatccacgggcagtgcaggcatgcgactggtgctgcggcggggcgtgctgcgggac
ggcgagggatacaccttcacgctcacggtgctgggccgctctggcgaggaggagggctgc
gcctccatccgcctgtcccccaaccgcccgccgctggggggctcttgccgcctcttccca
ctgggcgctgtgcacgccctcaccaccaaggtgcacttcgaatgcacgggctggcatgac
gcggaggatgctggcgccccgctggtgtacgccctgctgctgcggcgctgtcgccagggc
cactgcgaggagttctgtgtctacaagggcagcctctccagctacggagccgtgctgccc
ccgggtttcaggccacacttcgaggtgggcctggccgtggtggtgcaggaccagctggga
gccgctgtggtcgccctcaacaggtctttggccatcaccctcccagagcccaacggcagc
gcaacggggctcacagtctggctgcacgggctcaccgctagtgtgctcccagggctgctg
cggcaggccgatccccagcacgtcatcgagtactcgttggccctggtcaccgtgctgaac
gagtacgagcgggccctggacgtggcggcagagcccaagcacgagcggcagcaccgagcc
cagatacgcaagaacatcacggagactctggtgtccctgagggtccacactgtggatgac
atccagcagatcgctgctgcgctggcccagtgcatggggcccagcagggagctcgtatgc
cgctcgtgcctgaagcagacgctgcacaagctggaggccatgatgctcatcctgcaggca
gagaccaccgcgggcaccgtgacgcccaccgccatcggagacagcatcctcaacatcaca
ggagacctcatccacctggccagctcggacgtgcgggcaccacagccctcagagctggga
gccgagtcaccatctcggatggtggcgtcccaggcctacaacctgacctctgccctcatg
cgcatcctcatgcgctcccgcgtgctcaacgaggagcccctgacgctggcgggcgaggag
atcgtggcccagggcaagcgctcggacccgcggagcctgctgtgctatggcggcgcccca
gggcctggctgccacttctccatccccgaggctttcagcggggccctggccaacctcagt
gacgtggtgcagctcatctttctggtggactccaatccctttccctttggctatatcagc
aactacaccgtctccaccaaggtggcctcgatggcattccagacacaggccggcgcccag
atccccatcgagcggctggcctcagagcgcgccatcaccgtgaaggtgcccaacaactcg
gactgggctgcccggggccaccgcagctccgccaactccgccaactccgttgtggtccag
ccccaggcctccgtcggtgctgtggtcaccctggacagcagcaaccctgcggccgggctg
catctgcagctcaactatacgctgctggacggccactacctgtctgaggaacctgagccc
tacctggcagtctacctacactcggagccccggcccaatgagcacaactgctcggctagc
aggaggatccgcccagagtcactccagggtgctgaccaccggccctacaccttcttcatt
tccccggggagcagagacccagcggggagttaccatctgaacctctccagccacttccgc
tggtcggcgctgcaggtgtccgtgggcctgtacacgtccctgtgccagtacttcagcgag
gaggacatggtgtggcggacagaggggctgctgcccctggaggagacctcgccccgccag
gccgtctgcctcacccgccacctcaccgccttcggcgccagcctcttcgtgcccccaagc
catgtccgctttgtgtttcctgagccgacagcggatgtaaactacatcgtcatgctgaca
tgtgctgtgtgcctggtgacctacatggtcatggccgccatcctgcacaagctggaccag
ttggatgccagccggggccgcgccatccctttctgtgggcagcggggccgcttcaagtac
gagatcctcgtcaagacaggctggggccggggctcaggtaccacggcccacgtgggcatc
atgctgtatggggtggacagccggagcggccaccggcacctggacggcgacagagccttc
caccgcaacagcctggacatcttccggatcgccaccccgcacagcctgggtagcgtgtgg
aagatccgagtgtggcacgacaacaaagggctcagccctgcctggttcctgcagcacgtc
atcgtcagggacctgcagacggcacgcagcgccttcttcctggtcaatgactggctttcg
gtggagacggaggccaacgggggcctggtggagaaggaggtgctggccgcgagcgacgca
gcccttttgcgcttccggcgcctgctggtggctgagctgcagcgtggcttctttgacaag
cacatctggctctccatatgggaccggccgcctcgtagccgtttcactcgcatccagagg
gccacctgctgcgttctcctcatctgcctcttcctgggcgccaacgccgtgtggtacggg
gctgttggcgactctgcctacagcacggggcatgtgtccaggctgagcccgctgagcgtc
gacacagtcgctgttggcctggtgtccagcgtggttgtctatcccgtctacctggccatc
ctttttctcttccggatgtcccggagcaaggtggctgggagcccgagccccacacctgcc
gggcagcaggtgctggacatcgacagctgcctggactcgtccgtgctggacagctccttc
ctcacgttctcaggcctccacgctgagcaggcctttgttggacagatgaagagtgacttg
tttctggatgattctaagagtctggtgtgctggccctccggcgagggaacgctcagttgg
ccggacctgctcagtgacccgtccattgtgggtagcaatctgcggcagctggcacggggc
caggcgggccatgggctgggcccagaggaggacggcttctccctggccagcccctactcg
cctgccaaatccttctcagcatcagatgaagacctgatccagcaggtccttgccgagggg
gtcagcagcccagcccctacccaagacacccacatggaaacggacctgctcagcagcctg
tccagcactcctggggagaagacagagacgctggcgctgcagaggctgggggagctgggg
ccacccagcccaggcctgaactgggaacagccccaggcagcgaggctgtccaggacagga
ctggtggagggtctgcggaagcgcctgctgccggcctggtgtgcctccctggcccacggg
ctcagcctgctcctggtggctgtggctgtggctgtctcagggtgggtgggtgcgagcttc
cccccgggcgtgagtgttgcgtggctcctgtccagcagcgccagcttcctggcctcattc
ctcggctgggagccactgaaggtcttgctggaagccctgtacttctcactggtggccaag
cggctgcacccggatgaagatgacaccctggtagagagcccggctgtgacgcctgtgagc
gcacgtgtgccccgcgtacggccaccccacggctttgcactcttcctggccaaggaagaa
gcccgcaaggtcaagaggctacatggcatgctgcggagcctcctggtgtacatgcttttt
ctgctggtgaccctgctggccagctatggggatgcctcatgccatgggcacgcctaccgt
ctgcaaagcgccatcaagcaggagctgcacagccgggccttcctggccatcacgcggtct
gaggagctctggccatggatggcccacgtgctgctgccctacgtccacgggaaccagtcc
agcccagagctggggcccccacggctgcggcaggtgcggctgcaggaagcactctaccca
gaccctcccggccccagggtccacacgtgctcggccgcaggaggcttcagcaccagcgat
tacgacgttggctgggagagtcctcacaatggctcggggacgtgggcctattcagcgccg
gatctgctgggggcatggtcctggggctcctgtgccgtgtatgacagcgggggctacgtg
caggagctgggcctgagcctggaggagagccgcgaccggctgcgcttcctgcagctgcac
aactggctggacaacaggagccgcgctgtgttcctggagctcacgcgctacagcccggcc
gtggggctgcacgccgccgtcacgctgcgcctcgagttcccggcggccggccgcgccctg
gccgccctcagcgtccgcccctttgcgctgcgccgcctcagcgcgggcctctcgctgcct
ctgctcacctcggtgtgcctgctgctgttcgccgtgcacttcgccgtggccgaggcccgt
acttggcacagggaagggcgctggcgcgtgctgcggctcggagcctgggcgcggtggctg
ctggtggcgctgacggcggccacggcactggtacgcctcgcccagctgggtgccgctgac
cgccagtggacccgtttcgtgcgcggccgcccgcgccgcttcactagcttcgaccaggtg
gcgcagctgagctccgcagcccgtggcctggcggcctcgctgctcttcctgcttttggtc
aaggctgcccagcagctacgcttcgtgcgccagtggtccgtctttggcaagacattatgc
cgagctctgccagagctcctgggggtcaccttgggcctggtggtgctcggggtagcctac
gcccagctggccatcctgctcgtgtcttcctgtgtggactccctctggagcgtggcccag
gccctgttggtgctgtgccctgggactgggctctctaccctgtgtcctgccgagtcctgg
cacctgtcacccctgctgtgtgtggggctctgggcactgcggctgtggggcgccctacgg
ctgggggctgttattctccgctggcgctaccacgccttgcgtggagagctgtaccggccg
gcctgggagccccaggactacgagatggtggagttgttcctgcgcaggctgcgcctctgg
atgggcctcagcaaggtcaaggagttccgccacaaagtccgctttgaagggatggagccg
ctgccctctcgctcctccaggggctccaaggtatccccggatgtgcccccacccagcgct
ggctccgatgcctcgcacccctccacctcctccagccagctggatgggctgagcgtgagc
ctgggccggctggggacaaggtgtgagcctgagccctcccgcctccaagccgtgttcgag
gccctgctcacccagtttgaccgactcaaccaggccacagaggacgtctaccagctggag
cagcagctgcacagcctgcaaggccgcaggagcagccgggcgcccgccggatcttcccgt
ggcccatccccgggcctgcggccagcactgcccagccgccttgcccgggccagtcggggt
gtggacctggccactggccccagcaggacaccccttcgggccaagaacaaggtccacccc
agcagcacttag

DBGET integrated database retrieval system