KEGG   Homo sapiens (human): 5311Help
Entry
5311              CDS       T01001                                 

Gene name
PKD2, APKD2, PC2, PKD4, Pc-2, TRPP2
Definition
(RefSeq) polycystin 2, transient receptor potential cation channel
  KO
K04986  
polycystin 2
Organism
hsa  Homo sapiens (human)
Disease
H00542  
Polycystic kidney disease
Brite
Chromosome [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     5311 (PKD2)
Ion channels [BR:hsa04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPP (Polycystin)
   5311 (PKD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
4q22.1
AA seq 968 aa AA seqDB search
MVNSSRVQPQQPGDAKRPPAPRAPDPGRLMAGCAAVGASLAAPGGLCEQRGLEIEMQRIR
QAAARDPPAGAAASPSPPLSSCSRQAWSRDNPGFEAEEEEEEVEGEEGGMVVEMDVEWRP
GSRRSAASSAVSSVGARSRGLGGYHGAGHPSGRRRRREDQGPPCPSPVGGGDPLHRHLPL
EGQPPRVAWAERLVRGLRGLWGTRLMEESSTNREKYLKSVLRELVTYLLFLIVLCILTYG
MMSSNVYYYTRMMSQLFLDTPVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQ
TEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
RNGTAWIYTSEKDLNGSSHWGIIATYSGAGYYLDLSRTREETAAQVASLKKNVWLDRGTR
ATFIDFSVYNANINLFCVVRLLVEFPATGGVIPSWQFQPLKLIRYVTTFDFFLAACEIIF
CFFIFYYVVEEILEIRIHKLHYFRSFWNCLDVVIVVLSVVAIGINIYRTSNVEVLLQFLE
DQNTFPNFEHLAYWQIQFNNIAAVTVFFVWIKLFKFINFNRTMSQLSTTMSRCAKDLFGF
AIMFFIIFLAYAQLAYLVFGTQVDDFSTFQECIFTQFRIILGDINFAEIEEANRVLGPIY
FTTFVFFMFFILLNMFLAIINDTYSEVKSDLAQQKAEMELSDLIRKGYHKALVKLKLKKN
TVDDISESLRQGGGKLNFDELRQDLKGKGHTDAEIEAIFTKYDQDGDQELTEHEHQQMRD
DLEKEREDLDLDHSSLPRPMSSRSFPRSLDDSEEDDDEDSGHSSRRRGSISSGVSYEEFQ
VLVRRVDRMEHSIGSIVSKIDAVIVKLEIMERAKLKRREVLGRLLDGVAEDERLGRDSEI
HREQMERLVREELERWESDDAASQISHGLGTPVGLNGQPRPRSSRPSSSQSTEGMEGAGG
NGSSNVHV
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggtgaactccagtcgcgtgcagcctcagcagcccggggacgccaagcggccgcccgcg
ccccgcgcgccggacccgggccggctgatggctggctgcgcggccgtgggcgccagcctc
gccgccccgggcggcctctgcgagcagcggggcctggagatcgagatgcagcgcatccgg
caggcggccgcgcgggaccccccggccggagccgcggcctccccttctcctccgctctcg
tcgtgctcccggcaggcgtggagccgcgataaccccggcttcgaggccgaggaggaggag
gaggaggtggaaggggaagaaggcggaatggtggtggagatggacgtagagtggcgcccg
ggcagccggaggtcggccgcctcctcggccgtgagctccgtgggcgcgcggagccggggg
cttgggggctaccacggcgcgggccacccgagcgggaggcggcgccggcgagaggaccag
ggcccgccgtgccccagcccagtcggcggcggggacccgctgcatcgccacctccccctg
gaagggcagccgccccgagtggcctgggcggagaggctggttcgcgggctgcgaggtctc
tggggaacaagactcatggaggaaagcagcactaaccgagagaaataccttaaaagtgtt
ttacgggaactggtcacatacctcctttttctcatagtcttgtgcatcttgacctacggc
atgatgagctccaatgtgtactactacacccggatgatgtcacagctcttcctagacacc
cccgtgtccaaaacggagaaaactaactttaaaactctgtcttccatggaagacttctgg
aagttcacagaaggctccttattggatgggctgtactggaagatgcagcccagcaaccag
actgaagctgacaaccgaagtttcatcttctatgagaacctgctgttaggggttccacga
atacggcaactccgagtcagaaatggatcctgctctatcccccaggacttgagagatgaa
attaaagagtgctatgatgtctactctgtcagtagtgaagatagggctccctttgggccc
cgaaatggaaccgcttggatctacacaagtgaaaaagacttgaatggtagtagccactgg
ggaatcattgcaacttatagtggagctggctattatctggatttgtcaagaacaagagag
gaaacagctgcacaagttgctagcctcaagaaaaatgtctggctggaccgaggaaccagg
gcaacttttattgacttctcagtgtacaacgccaacattaacctgttctgtgtggtcagg
ttattggttgaattcccagcaacaggtggtgtgattccatcttggcaatttcagccttta
aagctgatccgatatgtcacaacttttgatttcttcctggcagcctgtgagattatcttt
tgtttctttatcttttactatgtggtggaagagatattggaaattcgcattcacaaacta
cactatttcaggagtttctggaattgtctggatgttgtgatcgttgtgctgtcagtggta
gctataggaattaacatatacagaacatcaaatgtggaggtgctactacagtttctggaa
gatcaaaatactttccccaactttgagcatctggcatattggcagatacagttcaacaat
atagctgctgtcacagtattttttgtctggattaagctcttcaaattcatcaattttaac
aggaccatgagccagctctcgacaaccatgtctcgatgtgccaaagacctgtttggcttt
gctattatgttcttcattattttcctagcgtatgctcagttggcataccttgtctttggc
actcaggtcgatgacttcagtactttccaagagtgtatcttcactcaattccgtatcatt
ttgggcgatatcaactttgcagagattgaggaagctaatcgagttttgggaccaatttat
ttcactacatttgtgttctttatgttcttcattcttttgaatatgtttttggctatcatc
aatgatacttactctgaagtgaaatctgacttggcacagcagaaagctgaaatggaactc
tcagatcttatcagaaagggctaccataaagctttggtcaaactaaaactgaaaaaaaat
accgtggatgacatttcagagagtctgcggcaaggaggaggcaagttaaactttgacgaa
cttcgacaagatctcaaagggaagggccatactgatgcagagattgaggcaatattcaca
aagtacgaccaagatggagaccaagaactgaccgaacatgaacatcagcagatgagagac
gacttggagaaagagagggaggacctggatttggatcacagttctttaccacgtcccatg
agcagccgaagtttccctcgaagcctggatgactctgaggaggatgacgatgaagatagc
ggacatagctccagaaggaggggaagcatttctagtggcgtttcttacgaagagtttcaa
gtcctggtgagacgagtggaccggatggagcattccatcggcagcatagtgtccaagatt
gacgccgtgatcgtgaagctagagattatggagcgagccaaactgaagaggagggaggtg
ctgggaaggctgttggatggggtggccgaggatgaaaggctgggtcgtgacagtgaaatc
catagggaacagatggaacggctagtacgtgaagagttggaacgctgggaatccgatgat
gcagcttcccagatcagtcatggtttaggcacgccagtgggactaaatggtcaacctcgc
cccagaagctcccgcccatcttcctcccaatctacagaaggcatggaaggtgcaggtgga
aatgggagttctaatgtccacgtatga

DBGET integrated database retrieval system