KEGG   Homo sapiens (human): 5315Help
Entry
5315              CDS       T01001                                 

Gene name
PKM, CTHBP, HEL-S-30, OIP3, PK3, PKM2, TCB, THBP1
Definition
pyruvate kinase, muscle (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Type II diabetes mellitus
Viral carcinogenesis
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    5315 (PKM)
   01230 Biosynthesis of amino acids
    5315 (PKM)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    5315 (PKM)
   00620 Pyruvate metabolism
    5315 (PKM)
  Nucleotide metabolism
   00230 Purine metabolism
    5315 (PKM)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    5315 (PKM)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    5315 (PKM)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     5315 (PKM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5315 (PKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q22
AA seq 605 aa AA seqDB search
MQWSSERGERLLTPGACSSEVPSAVPSRSGGSPGHTVFSSERSLLVRPRSHPEPKGEHYV
TGSPTPENQRTSAAMSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTG
IICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYR
PVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICK
VVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDI
QDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEA
SDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGS
DVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHST
DLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLY
RGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMR
VVPVP
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggagctcagagagaggagaacggctcctcacgcctggggcctgctcttcagaa
gtccccagcgccgttccttccagatcaggcggctctccagggcacaccgtattcagctct
gagcggtctttgctagtgaggccaaggagccaccctgagccaaaaggggagcattatgtc
accggaagcccaaccccagagaaccaaaggacctcagcagccatgtcgaagccccatagt
gaagccgggactgccttcattcagacccagcagctgcacgcagccatggctgacacattc
ctggagcacatgtgccgcctggacattgattcaccacccatcacagcccggaacactggc
atcatctgtaccattggcccagcttcccgatcagtggagacgttgaaggagatgattaag
tctggaatgaatgtggctcgtctgaacttctctcatggaactcatgagtaccatgcggag
accatcaagaatgtgcgcacagccacggaaagctttgcttctgaccccatcctctaccgg
cccgttgctgtggctctagacactaaaggacctgagatccgaactgggctcatcaagggc
agcggcactgcagaggtggagctgaagaagggagccactctcaaaatcacgctggataac
gcctacatggaaaagtgtgacgagaacatcctgtggctggactacaagaacatctgcaag
gtggtggaagtgggcagcaagatctacgtggatgatgggcttatttctctccaggtgaag
cagaaaggtgccgacttcctggtgacggaggtggaaaatggtggctccttgggcagcaag
aagggtgtgaaccttcctggggctgctgtggacttgcctgctgtgtcggagaaggacatc
caggatctgaagtttggggtcgagcaggatgttgatatggtgtttgcgtcattcatccgc
aaggcatctgatgtccatgaagttaggaaggtcctgggagagaagggaaagaacatcaag
attatcagcaaaatcgagaatcatgagggggttcggaggtttgatgaaatcctggaggcc
agtgatgggatcatggtggctcgtggtgatctaggcattgagattcctgcagagaaggtc
ttccttgctcagaagatgatgattggacggtgcaaccgagctgggaagcctgtcatctgt
gctactcagatgctggagagcatgatcaagaagccccgccccactcgggctgaaggcagt
gatgtggccaatgcagtcctggatggagccgactgcatcatgctgtctggagaaacagcc
aaaggggactatcctctggaggctgtgcgcatgcagcacctgatagctcgtgaggctgag
gcagccatgttccaccgcaagctgtttgaagaacttgtgcgagcctcaagtcactccaca
gacctcatggaagccatggccatgggcagcgtggaggcttcttataagtgtttagcagca
gctttgatagttctgacggagtctggcaggtctgctcaccaggtggccagataccgccca
cgtgcccccatcattgctgtgacccggaatccccagacagctcgtcaggcccacctgtac
cgtggcatcttccctgtgctgtgcaaggacccagtccaggaggcctgggctgaggacgtg
gacctccgggtgaactttgccatgaatgttggcaaggcccgaggcttcttcaagaaggga
gatgtggtcattgtgctgaccggatggcgccctggctccggcttcaccaacaccatgcgt
gttgttcctgtgccgtga

DBGET integrated database retrieval system