KEGG   Homo sapiens (human): 5315Help
Entry
5315              CDS       T01001                                 

Gene name
PKM, CTHBP, HEL-S-30, OIP3, PK3, PKM2, TCB, THBP1
Definition
pyruvate kinase, muscle (EC:2.7.1.40)
Orthology
K00873  
pyruvate kinase [EC:2.7.1.40]
Organism
hsa  Homo sapiens (human)
Pathway
Glycolysis / Gluconeogenesis
Purine metabolism
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Type II diabetes mellitus
Viral carcinogenesis
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Overview; Carbon metabolism [PATH:hsa01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:hsa01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:hsa00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:hsa00620]
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:hsa00230]
Human Diseases; Cancers; Viral carcinogenesis [PATH:hsa05203]
Human Diseases; Endocrine and metabolic diseases; Type II diabetes mellitus [PATH:hsa04930]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15q22
AA seq 605 aa AA seqDB search
MQWSSERGERLLTPGACSSEVPSAVPSRSGGSPGHTVFSSERSLLVRPRSHPEPKGEHYV
TGSPTPENQRTSAAMSKPHSEAGTAFIQTQQLHAAMADTFLEHMCRLDIDSPPITARNTG
IICTIGPASRSVETLKEMIKSGMNVARLNFSHGTHEYHAETIKNVRTATESFASDPILYR
PVAVALDTKGPEIRTGLIKGSGTAEVELKKGATLKITLDNAYMEKCDENILWLDYKNICK
VVEVGSKIYVDDGLISLQVKQKGADFLVTEVENGGSLGSKKGVNLPGAAVDLPAVSEKDI
QDLKFGVEQDVDMVFASFIRKASDVHEVRKVLGEKGKNIKIISKIENHEGVRRFDEILEA
SDGIMVARGDLGIEIPAEKVFLAQKMMIGRCNRAGKPVICATQMLESMIKKPRPTRAEGS
DVANAVLDGADCIMLSGETAKGDYPLEAVRMQHLIAREAEAAMFHRKLFEELVRASSHST
DLMEAMAMGSVEASYKCLAAALIVLTESGRSAHQVARYRPRAPIIAVTRNPQTARQAHLY
RGIFPVLCKDPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMR
VVPVP
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggagctcagagagaggagaacggctcctcacgcctggggcctgctcttcagaa
gtccccagcgccgttccttccagatcaggcggctctccagggcacaccgtattcagctct
gagcggtctttgctagtgaggccaaggagccaccctgagccaaaaggggagcattatgtc
accggaagcccaaccccagagaaccaaaggacctcagcagccatgtcgaagccccatagt
gaagccgggactgccttcattcagacccagcagctgcacgcagccatggctgacacattc
ctggagcacatgtgccgcctggacattgattcaccacccatcacagcccggaacactggc
atcatctgtaccattggcccagcttcccgatcagtggagacgttgaaggagatgattaag
tctggaatgaatgtggctcgtctgaacttctctcatggaactcatgagtaccatgcggag
accatcaagaatgtgcgcacagccacggaaagctttgcttctgaccccatcctctaccgg
cccgttgctgtggctctagacactaaaggacctgagatccgaactgggctcatcaagggc
agcggcactgcagaggtggagctgaagaagggagccactctcaaaatcacgctggataac
gcctacatggaaaagtgtgacgagaacatcctgtggctggactacaagaacatctgcaag
gtggtggaagtgggcagcaagatctacgtggatgatgggcttatttctctccaggtgaag
cagaaaggtgccgacttcctggtgacggaggtggaaaatggtggctccttgggcagcaag
aagggtgtgaaccttcctggggctgctgtggacttgcctgctgtgtcggagaaggacatc
caggatctgaagtttggggtcgagcaggatgttgatatggtgtttgcgtcattcatccgc
aaggcatctgatgtccatgaagttaggaaggtcctgggagagaagggaaagaacatcaag
attatcagcaaaatcgagaatcatgagggggttcggaggtttgatgaaatcctggaggcc
agtgatgggatcatggtggctcgtggtgatctaggcattgagattcctgcagagaaggtc
ttccttgctcagaagatgatgattggacggtgcaaccgagctgggaagcctgtcatctgt
gctactcagatgctggagagcatgatcaagaagccccgccccactcgggctgaaggcagt
gatgtggccaatgcagtcctggatggagccgactgcatcatgctgtctggagaaacagcc
aaaggggactatcctctggaggctgtgcgcatgcagcacctgatagctcgtgaggctgag
gcagccatgttccaccgcaagctgtttgaagaacttgtgcgagcctcaagtcactccaca
gacctcatggaagccatggccatgggcagcgtggaggcttcttataagtgtttagcagca
gctttgatagttctgacggagtctggcaggtctgctcaccaggtggccagataccgccca
cgtgcccccatcattgctgtgacccggaatccccagacagctcgtcaggcccacctgtac
cgtggcatcttccctgtgctgtgcaaggacccagtccaggaggcctgggctgaggacgtg
gacctccgggtgaactttgccatgaatgttggcaaggcccgaggcttcttcaagaaggga
gatgtggtcattgtgctgaccggatggcgccctggctccggcttcaccaacaccatgcgt
gttgttcctgtgccgtga

DBGET integrated database retrieval system