KEGG   Homo sapiens (human): 5327Help
Entry
5327              CDS       T01001                                 

Gene name
PLAT, T-PA, TPA
Definition
plasminogen activator, tissue (EC:3.4.21.68)
Orthology
K01343  
tissue plasminogen activator [EC:3.4.21.68]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Transcriptional misregulation in cancer
Class
Organismal Systems; Immune system; Complement and coagulation cascades [PATH:hsa04610]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:hsa05202]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p12
AA seq 562 aa AA seqDB search
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaatgaagagagggctctgctgtgtgctgctgctgtgtggagcagtcttcgtt
tcgcccagccaggaaatccatgcccgattcagaagaggagccagatcttaccaagtgatc
tgcagagatgaaaaaacgcagatgatataccagcaacatcagtcatggctgcgccctgtg
ctcagaagcaaccgggtggaatattgctggtgcaacagtggcagggcacagtgccactca
gtgcctgtcaaaagttgcagcgagccaaggtgtttcaacgggggcacctgccagcaggcc
ctgtacttctcagatttcgtgtgccagtgccccgaaggatttgctgggaagtgctgtgaa
atagataccagggccacgtgctacgaggaccagggcatcagctacaggggcacgtggagc
acagcggagagtggcgccgagtgcaccaactggaacagcagcgcgttggcccagaagccc
tacagcgggcggaggccagacgccatcaggctgggcctggggaaccacaactactgcaga
aacccagatcgagactcaaagccctggtgctacgtctttaaggcggggaagtacagctca
gagttctgcagcacccctgcctgctctgagggaaacagtgactgctactttgggaatggg
tcagcctaccgtggcacgcacagcctcaccgagtcgggtgcctcctgcctcccgtggaat
tccatgatcctgataggcaaggtttacacagcacagaaccccagtgcccaggcactgggc
ctgggcaaacataattactgccggaatcctgatggggatgccaagccctggtgccacgtg
ctgaagaaccgcaggctgacgtgggagtactgtgatgtgccctcctgctccacctgcggc
ctgagacagtacagccagcctcagtttcgcatcaaaggagggctcttcgccgacatcgcc
tcccacccctggcaggctgccatctttgccaagcacaggaggtcgcccggagagcggttc
ctgtgcgggggcatactcatcagctcctgctggattctctctgccgcccactgcttccag
gagaggtttccgccccaccacctgacggtgatcttgggcagaacataccgggtggtccct
ggcgaggaggagcagaaatttgaagtcgaaaaatacattgtccataaggaattcgatgat
gacacttacgacaatgacattgcgctgctgcagctgaaatcggattcgtcccgctgtgcc
caggagagcagcgtggtccgcactgtgtgccttcccccggcggacctgcagctgccggac
tggacggagtgtgagctctccggctacggcaagcatgaggccttgtctcctttctattcg
gagcggctgaaggaggctcatgtcagactgtacccatccagccgctgcacatcacaacat
ttacttaacagaacagtcaccgacaacatgctgtgtgctggagacactcggagcggcggg
ccccaggcaaacttgcacgacgcctgccagggcgattcgggaggccccctggtgtgtctg
aacgatggccgcatgactttggtgggcatcatcagctggggcctgggctgtggacagaag
gatgtcccgggtgtgtacaccaaggttaccaactacctagactggattcgtgacaacatg
cgaccgtga

DBGET integrated database retrieval system