KEGG   Homo sapiens (human): 5327Help
Entry
5327              CDS       T01001                                 

Gene name
PLAT, T-PA, TPA
Definition
plasminogen activator, tissue (EC:3.4.21.68)
Orthology
K01343  
tissue plasminogen activator [EC:3.4.21.68]
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    5327 (PLAT)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    5327 (PLAT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     5327 (PLAT)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5327 (PLAT)
Heparan sulfate/heparin binding proteins [BR:hsa00536]
 Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
  5327 (PLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8p12
AA seq 562 aa AA seqDB search
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaatgaagagagggctctgctgtgtgctgctgctgtgtggagcagtcttcgtt
tcgcccagccaggaaatccatgcccgattcagaagaggagccagatcttaccaagtgatc
tgcagagatgaaaaaacgcagatgatataccagcaacatcagtcatggctgcgccctgtg
ctcagaagcaaccgggtggaatattgctggtgcaacagtggcagggcacagtgccactca
gtgcctgtcaaaagttgcagcgagccaaggtgtttcaacgggggcacctgccagcaggcc
ctgtacttctcagatttcgtgtgccagtgccccgaaggatttgctgggaagtgctgtgaa
atagataccagggccacgtgctacgaggaccagggcatcagctacaggggcacgtggagc
acagcggagagtggcgccgagtgcaccaactggaacagcagcgcgttggcccagaagccc
tacagcgggcggaggccagacgccatcaggctgggcctggggaaccacaactactgcaga
aacccagatcgagactcaaagccctggtgctacgtctttaaggcggggaagtacagctca
gagttctgcagcacccctgcctgctctgagggaaacagtgactgctactttgggaatggg
tcagcctaccgtggcacgcacagcctcaccgagtcgggtgcctcctgcctcccgtggaat
tccatgatcctgataggcaaggtttacacagcacagaaccccagtgcccaggcactgggc
ctgggcaaacataattactgccggaatcctgatggggatgccaagccctggtgccacgtg
ctgaagaaccgcaggctgacgtgggagtactgtgatgtgccctcctgctccacctgcggc
ctgagacagtacagccagcctcagtttcgcatcaaaggagggctcttcgccgacatcgcc
tcccacccctggcaggctgccatctttgccaagcacaggaggtcgcccggagagcggttc
ctgtgcgggggcatactcatcagctcctgctggattctctctgccgcccactgcttccag
gagaggtttccgccccaccacctgacggtgatcttgggcagaacataccgggtggtccct
ggcgaggaggagcagaaatttgaagtcgaaaaatacattgtccataaggaattcgatgat
gacacttacgacaatgacattgcgctgctgcagctgaaatcggattcgtcccgctgtgcc
caggagagcagcgtggtccgcactgtgtgccttcccccggcggacctgcagctgccggac
tggacggagtgtgagctctccggctacggcaagcatgaggccttgtctcctttctattcg
gagcggctgaaggaggctcatgtcagactgtacccatccagccgctgcacatcacaacat
ttacttaacagaacagtcaccgacaacatgctgtgtgctggagacactcggagcggcggg
ccccaggcaaacttgcacgacgcctgccagggcgattcgggaggccccctggtgtgtctg
aacgatggccgcatgactttggtgggcatcatcagctggggcctgggctgtggacagaag
gatgtcccgggtgtgtacaccaaggttaccaactacctagactggattcgtgacaacatg
cgaccgtga

DBGET integrated database retrieval system