KEGG   Homo sapiens (human): 5327Help
Entry
5327              CDS       T01001                                 

Gene name
PLAT, T-PA, TPA
Definition
(RefSeq) plasminogen activator, tissue type
  KO
K01343  
tissue plasminogen activator [EC:3.4.21.68]
Organism
hsa  Homo sapiens (human)
Pathway
Apelin signaling pathway
Complement and coagulation cascades
Transcriptional misregulation in cancer
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    5327 (PLAT)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    5327 (PLAT)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    5327 (PLAT)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    5327 (PLAT)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     5327 (PLAT)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5327 (PLAT)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
   5327 (PLAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
Pharos: 
P00750(Tclin)
UniProt: 
Structure
PDB: 

Jmol
Position
8p11.21
AA seq 562 aa AA seqDB search
MDAMKRGLCCVLLLCGAVFVSPSQEIHARFRRGARSYQVICRDEKTQMIYQQHQSWLRPV
LRSNRVEYCWCNSGRAQCHSVPVKSCSEPRCFNGGTCQQALYFSDFVCQCPEGFAGKCCE
IDTRATCYEDQGISYRGTWSTAESGAECTNWNSSALAQKPYSGRRPDAIRLGLGNHNYCR
NPDRDSKPWCYVFKAGKYSSEFCSTPACSEGNSDCYFGNGSAYRGTHSLTESGASCLPWN
SMILIGKVYTAQNPSAQALGLGKHNYCRNPDGDAKPWCHVLKNRRLTWEYCDVPSCSTCG
LRQYSQPQFRIKGGLFADIASHPWQAAIFAKHRRSPGERFLCGGILISSCWILSAAHCFQ
ERFPPHHLTVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSRCA
QESSVVRTVCLPPADLQLPDWTECELSGYGKHEALSPFYSERLKEAHVRLYPSSRCTSQH
LLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQK
DVPGVYTKVTNYLDWIRDNMRP
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggatgcaatgaagagagggctctgctgtgtgctgctgctgtgtggagcagtcttcgtt
tcgcccagccaggaaatccatgcccgattcagaagaggagccagatcttaccaagtgatc
tgcagagatgaaaaaacgcagatgatataccagcaacatcagtcatggctgcgccctgtg
ctcagaagcaaccgggtggaatattgctggtgcaacagtggcagggcacagtgccactca
gtgcctgtcaaaagttgcagcgagccaaggtgtttcaacgggggcacctgccagcaggcc
ctgtacttctcagatttcgtgtgccagtgccccgaaggatttgctgggaagtgctgtgaa
atagataccagggccacgtgctacgaggaccagggcatcagctacaggggcacgtggagc
acagcggagagtggcgccgagtgcaccaactggaacagcagcgcgttggcccagaagccc
tacagcgggcggaggccagacgccatcaggctgggcctggggaaccacaactactgcaga
aacccagatcgagactcaaagccctggtgctacgtctttaaggcggggaagtacagctca
gagttctgcagcacccctgcctgctctgagggaaacagtgactgctactttgggaatggg
tcagcctaccgtggcacgcacagcctcaccgagtcgggtgcctcctgcctcccgtggaat
tccatgatcctgataggcaaggtttacacagcacagaaccccagtgcccaggcactgggc
ctgggcaaacataattactgccggaatcctgatggggatgccaagccctggtgccacgtg
ctgaagaaccgcaggctgacgtgggagtactgtgatgtgccctcctgctccacctgcggc
ctgagacagtacagccagcctcagtttcgcatcaaaggagggctcttcgccgacatcgcc
tcccacccctggcaggctgccatctttgccaagcacaggaggtcgcccggagagcggttc
ctgtgcgggggcatactcatcagctcctgctggattctctctgccgcccactgcttccag
gagaggtttccgccccaccacctgacggtgatcttgggcagaacataccgggtggtccct
ggcgaggaggagcagaaatttgaagtcgaaaaatacattgtccataaggaattcgatgat
gacacttacgacaatgacattgcgctgctgcagctgaaatcggattcgtcccgctgtgcc
caggagagcagcgtggtccgcactgtgtgccttcccccggcggacctgcagctgccggac
tggacggagtgtgagctctccggctacggcaagcatgaggccttgtctcctttctattcg
gagcggctgaaggaggctcatgtcagactgtacccatccagccgctgcacatcacaacat
ttacttaacagaacagtcaccgacaacatgctgtgtgctggagacactcggagcggcggg
ccccaggcaaacttgcacgacgcctgccagggcgattcgggaggccccctggtgtgtctg
aacgatggccgcatgactttggtgggcatcatcagctggggcctgggctgtggacagaag
gatgtcccgggtgtgtacaccaaggttaccaactacctagactggattcgtgacaacatg
cgaccgtga

DBGET integrated database retrieval system