KEGG   Homo sapiens (human): 5328Help
Entry
5328              CDS       T01001                                 

Gene name
PLAU, ATF, BDPLT5, QPD, UPA, URK, u-PA
Definition
(RefSeq) plasminogen activator, urokinase (EC:3.4.21.73)
  KO
K01348  
urokinase plasminogen activator [EC:3.4.21.73]
Organism
hsa  Homo sapiens (human)
Pathway
NF-kappa B signaling pathway
Complement and coagulation cascades
Transcriptional misregulation in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    5328 (PLAU)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    5328 (PLAU)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    5328 (PLAU)
   05206 MicroRNAs in cancer
    5328 (PLAU)
   05205 Proteoglycans in cancer
    5328 (PLAU)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.73  u-plasminogen activator
     5328 (PLAU)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   5328 (PLAU)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
   5328 (PLAU)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10q22.2
AA seq 431 aa AA seqDB search
MRALLARLLLCVLVVSDSKGSNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQ
HCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHN
YCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKII
GGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLG
RSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICL
PSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKML
CAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIR
SHTKEENGLAL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgagagccctgctggcgcgcctgcttctctgcgtcctggtcgtgagcgactccaaaggc
agcaatgaacttcatcaagttccatcgaactgtgactgtctaaatggaggaacatgtgtg
tccaacaagtacttctccaacattcactggtgcaactgcccaaagaaattcggagggcag
cactgtgaaatagataagtcaaaaacctgctatgaggggaatggtcacttttaccgagga
aaggccagcactgacaccatgggccggccctgcctgccctggaactctgccactgtcctt
cagcaaacgtaccatgcccacagatctgatgctcttcagctgggcctggggaaacataat
tactgcaggaacccagacaaccggaggcgaccctggtgctatgtgcaggtgggcctaaag
ccgcttgtccaagagtgcatggtgcatgactgcgcagatggaaaaaagccctcctctcct
ccagaagaattaaaatttcagtgtggccaaaagactctgaggccccgctttaagattatt
gggggagaattcaccaccatcgagaaccagccctggtttgcggccatctacaggaggcac
cgggggggctctgtcacctacgtgtgtggaggcagcctcatcagcccttgctgggtgatc
agcgccacacactgcttcattgattacccaaagaaggaggactacatcgtctacctgggt
cgctcaaggcttaactccaacacgcaaggggagatgaagtttgaggtggaaaacctcatc
ctacacaaggactacagcgctgacacgcttgctcaccacaacgacattgccttgctgaag
atccgttccaaggagggcaggtgtgcgcagccatcccggactatacagaccatctgcctg
ccctcgatgtataacgatccccagtttggcacaagctgtgagatcactggctttggaaaa
gagaattctaccgactatctctatccggagcagctgaaaatgactgttgtgaagctgatt
tcccaccgggagtgtcagcagccccactactacggctctgaagtcaccaccaaaatgctg
tgtgctgctgacccacagtggaaaacagattcctgccagggagactcagggggacccctc
gtctgttccctccaaggccgcatgactttgactggaattgtgagctggggccgtggatgt
gccctgaaggacaagccaggcgtctacacgagagtctcacacttcttaccctggatccgc
agtcacaccaaggaagagaatggcctggccctctga

DBGET integrated database retrieval system