KEGG   Homo sapiens (human): 5329Help
Entry
5329              CDS       T01001                                 

Gene name
PLAUR, CD87, U-PAR, UPAR, URKR
Definition
(RefSeq) plasminogen activator, urokinase receptor
  KO
K03985  
plasminogen activator, urokinase receptor
Organism
hsa  Homo sapiens (human)
Pathway
Complement and coagulation cascades
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    5329 (PLAUR)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5329 (PLAUR)
Cellular antigens [BR:hsa04090]
 Proteins
  5329 (PLAUR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  5329 (PLAUR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q13
AA seq 335 aa AA seqDB search
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacccgccgctgctgccgctgctgctgctgctccacacctgcgtcccagcctct
tggggcctgcggtgcatgcagtgtaagaccaacggggattgccgtgtggaagagtgcgcc
ctgggacaggacctctgcaggaccacgatcgtgcgcttgtgggaagaaggagaagagctg
gagctggtggagaaaagctgtacccactcagagaagaccaacaggaccctgagctatcgg
actggcttgaagatcaccagccttaccgaggttgtgtgtgggttagacttgtgcaaccag
ggcaactctggccgggctgtcacctattcccgaagccgttacctcgaatgcatttcctgt
ggctcatcagacatgagctgtgagaggggccggcaccagagcctgcagtgccgcagccct
gaagaacagtgcctggatgtggtgacccactggatccaggaaggtgaagaagggcgtcca
aaggatgaccgccacctccgtggctgtggctaccttcccggctgcccgggctccaatggt
ttccacaacaacgacaccttccacttcctgaaatgctgcaacaccaccaaatgcaacgag
ggcccaatcctggagcttgaaaatctgccgcagaatggccgccagtgttacagctgcaag
gggaacagcacccatggatgctcctctgaagagactttcctcattgactgccgaggcccc
atgaatcaatgtctggtagccaccggcactcacgaaccgaaaaaccaaagctatatggta
agaggctgtgcaaccgcctcaatgtgccaacatgcccacctgggtgacgccttcagcatg
aaccacattgatgtctcctgctgtactaaaagtggctgtaaccacccagacctggatgtc
cagtaccgcagtggggctgctcctcagcctggccctgcccatctcagcctcaccatcacc
ctgctaatgactgccagactgtggggaggcactctcctctggacctaa

DBGET integrated database retrieval system