KEGG   Homo sapiens (human): 5329Help
Entry
5329              CDS       T01001                                 

Gene name
PLAUR, CD87, U-PAR, UPAR, URKR
Definition
(RefSeq) plasminogen activator, urokinase receptor
  KO
K03985  plasminogen activator, urokinase receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04610  Complement and coagulation cascades
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    5329 (PLAUR)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    5329 (PLAUR)
CD molecules [BR:hsa04090]
 Proteins
  5329 (PLAUR)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  5329 (PLAUR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPAR_LY6 Toxin_TOLIP
Motif
Other DBs
NCBI-GeneID: 5329
NCBI-ProteinID: NP_002650
OMIM: 173391
HGNC: 9053
Ensembl: ENSG00000011422
Vega: OTTHUMG00000182778
Pharos: Q03405(Tchem)
UniProt: Q03405
Structure
PDB: 

Jmol
Position
19q13.31
AA seq 335 aa AA seqDB search
MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacccgccgctgctgccgctgctgctgctgctccacacctgcgtcccagcctct
tggggcctgcggtgcatgcagtgtaagaccaacggggattgccgtgtggaagagtgcgcc
ctgggacaggacctctgcaggaccacgatcgtgcgcttgtgggaagaaggagaagagctg
gagctggtggagaaaagctgtacccactcagagaagaccaacaggaccctgagctatcgg
actggcttgaagatcaccagccttaccgaggttgtgtgtgggttagacttgtgcaaccag
ggcaactctggccgggctgtcacctattcccgaagccgttacctcgaatgcatttcctgt
ggctcatcagacatgagctgtgagaggggccggcaccagagcctgcagtgccgcagccct
gaagaacagtgcctggatgtggtgacccactggatccaggaaggtgaagaagggcgtcca
aaggatgaccgccacctccgtggctgtggctaccttcccggctgcccgggctccaatggt
ttccacaacaacgacaccttccacttcctgaaatgctgcaacaccaccaaatgcaacgag
ggcccaatcctggagcttgaaaatctgccgcagaatggccgccagtgttacagctgcaag
gggaacagcacccatggatgctcctctgaagagactttcctcattgactgccgaggcccc
atgaatcaatgtctggtagccaccggcactcacgaaccgaaaaaccaaagctatatggta
agaggctgtgcaaccgcctcaatgtgccaacatgcccacctgggtgacgccttcagcatg
aaccacattgatgtctcctgctgtactaaaagtggctgtaaccacccagacctggatgtc
cagtaccgcagtggggctgctcctcagcctggccctgcccatctcagcctcaccatcacc
ctgctaatgactgccagactgtggggaggcactctcctctggacctaa

DBGET integrated database retrieval system