KEGG   Homo sapiens (human): 533Help
Entry
533               CDS       T01001                                 

Gene name
ATP6V0B, ATP6F, HATPL, VMA16
Definition
ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (EC:3.6.3.14)
Orthology
K03661  
V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Class
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:hsa00190]
Cellular Processes; Transport and catabolism; Phagosome [PATH:hsa04145]
Cellular Processes; Transport and catabolism; Lysosome [PATH:hsa04142]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:hsa04721]
Human Diseases; Immune diseases; Rheumatoid arthritis [PATH:hsa05323]
Human Diseases; Infectious diseases; Vibrio cholerae infection [PATH:hsa05110]
Human Diseases; Infectious diseases; Epithelial cell signaling in Helicobacter pylori infection [PATH:hsa05120]
Human Diseases; Infectious diseases; Tuberculosis [PATH:hsa05152]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p32.3
AA seq 158 aa AA seqDB search
MWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIM
AIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADA
QNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccaacctgggcattggcctagctatctccctgtctgtggttggggcagcctgg
ggcatctatattaccggctcctccatcattggtggaggagtgaaggcccccaggatcaag
accaagaacctggtcagcatcatcttctgtgaggctgtggccatctacggcatcatcatg
gcaattgtcattagcaacatggctgagcctttcagtgccacagaccccaaggccatcggc
catcggaactaccatgcaggctactccatgtttggggctggcctcaccgtaggcctgtct
aacctcttctgtggagtctgcgtgggcatcgtgggcagtggggctgccctggccgatgct
cagaaccccagcctctttgtaaagattctcatcgtggagatctttggcagcgccattggc
ctctttggggtcatcgtcgcaattcttcagacctccagagtgaagatgggtgactag

DBGET integrated database retrieval system