KEGG   Homo sapiens (human): 533Help
Entry
533               CDS       T01001                                 

Gene name
ATP6V0B, ATP6F, HATPL, VMA16
Definition
ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b (EC:3.6.3.14)
Orthology
K03661  
V-type H+-transporting ATPase 21kDa proteolipid subunit
Organism
hsa  Homo sapiens (human)
Pathway
Oxidative phosphorylation
Metabolic pathways
Lysosome
Phagosome
Synaptic vesicle cycle
Vibrio cholerae infection
Epithelial cell signaling in Helicobacter pylori infection
Tuberculosis
Rheumatoid arthritis
Module
V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    533 (ATP6V0B)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    533 (ATP6V0B)
   04142 Lysosome
    533 (ATP6V0B)
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    533 (ATP6V0B)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    533 (ATP6V0B)
  Infectious diseases
   05110 Vibrio cholerae infection
    533 (ATP6V0B)
   05120 Epithelial cell signaling in Helicobacter pylori infection
    533 (ATP6V0B)
   05152 Tuberculosis
    533 (ATP6V0B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
OMIM: 
HGNC: 
HPRD: 
Ensembl: 
Vega: 
UniProt: 
Position
1p32.3
AA seq 158 aa AA seqDB search
MWSNLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIM
AIVISNMAEPFSATDPKAIGHRNYHAGYSMFGAGLTVGLSNLFCGVCVGIVGSGAALADA
QNPSLFVKILIVEIFGSAIGLFGVIVAILQTSRVKMGD
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtggtccaacctgggcattggcctagctatctccctgtctgtggttggggcagcctgg
ggcatctatattaccggctcctccatcattggtggaggagtgaaggcccccaggatcaag
accaagaacctggtcagcatcatcttctgtgaggctgtggccatctacggcatcatcatg
gcaattgtcattagcaacatggctgagcctttcagtgccacagaccccaaggccatcggc
catcggaactaccatgcaggctactccatgtttggggctggcctcaccgtaggcctgtct
aacctcttctgtggagtctgcgtgggcatcgtgggcagtggggctgccctggccgatgct
cagaaccccagcctctttgtaaagattctcatcgtggagatctttggcagcgccattggc
ctctttggggtcatcgtcgcaattcttcagacctccagagtgaagatgggtgactag

DBGET integrated database retrieval system