KEGG   Homo sapiens (human): 5334Help
Entry
5334              CDS       T01001                                 

Gene name
PLCL1, PLCE, PLCL, PLDL1, PPP1R127, PRIP
Definition
(RefSeq) phospholipase C like 1
  KO
K15375  
inactive phospholipase C-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
GABAergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    5334 (PLCL1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5334 (PLCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
OMIM: 
HGNC: 
Ensembl: 
Vega: 
Pharos: 
Q15111(Tbio)
UniProt: 
Position
2q33.1
AA seq 1095 aa AA seqDB search
MAEGAAGREDPAPPDAAGGEDDPRVGPDAAGDCVTAASGGRMRDRRSGVALPGAAGTPAD
SEAGLLEAARATPRRSSIIKDPSNQKCGGRKKTVSFSSMPSEKKISSANDCISFMQAGCE
LKKVRPNSRIYNRFFTLDTDLQALRWEPSKKDLEKAKLDISAIKEIRLGKNTETFRNNGL
ADQICEDCAFSILHGENYESLDLVANSADVANIWVSGLRYLVSRSKQPLDFMEGNQNTPR
FMWLKTVFEAADVDGNGIMLEDTSVELIKQLNPTLKEAKIRLKFKEIQKSKEKLTTRVTE
EEFCEAFCELCTRPEVYFLLVQISKNKEYLDANDLMLFLEAEQGVTHITEDICLDIIRRY
ELSEEGRQKGFLAIDGFTQYLLSSECDIFDPEQKKVAQDMTQPLSHYYINASHNTYLIED
QFRGPADINGYIRALKMGCRSVELDVSDGSDNEPILCNRNNMTTHVSFRSVIEVINKFAF
VASEYPLILCLGNHCSLPQQKVMAQQMKKVFGNKLYTEAPLPSESYLPSPEKLKRMIIVK
GKKLPSDPDVLEGEVTDEDEEAEMSRRMSVDYNGEQKQIRLCRELSDLVSICKSVQYRDF
ELSMKSQNYWEMCSFSETEASRIANEYPEDFVNYNKKFLSRIYPSAMRIDSSNLNPQDFW
NCGCQIVAMNFQTPGPMMDLHTGWFLQNGGCGYVLRPSIMRDEVSYFSANTKGILPGVSP
LALHIKIISGQNFPKPKGACAKGDVIDPYVCIEIHGIPADCSEQRTKTVQQNSDNPIFDE
TFEFQVNLPELAMIRFVVLDDDYIGDEFIGQYTIPFECLQPGYRHVPLRSFVGDIMEHVT
LFVHIAITNRSGGGKAQKRSLSVRMGKKVREYTMLRNIGLKTIDDIFKIAVHPLREAIDM
RENMQNAIVSIKELCGLPPIASLKQCLLTLSSRLITSDNTPSVSLVMKDSFPYLEPLGAI
PDVQKKMLTAYDLMIQESRFLIEMADTVQEKIVQCQKAGMEFHEELHNLGAKEGLKGRKL
NKATESFAWNITVLKGQGDLLKNAKNEAIENMKQIQLACLSCGLSKAPSSSAEAKSKRSL
EAIEEKESSEENGKL
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atggccgagggcgcggccggcagggaggatccggcgccgcccgacgcggcggggggcgaa
gacgacccccgagtgggcccggatgccgccggggactgcgtgacggcggcctctgggggc
cggatgagggaccgtcgcagcggggtcgcactgccaggcgccgcggggaccccagcggac
agcgaggcgggcctcctggaggcagcacgggcgaccccccggcgcagcagcatcatcaag
gatccttcaaaccaaaaatgtggtggaagaaagaaaaccgtgtctttcagcagcatgcca
tcggaaaagaaaattagcagtgcaaatgactgcatcagcttcatgcaagctggctgtgag
ttgaagaaagtccggccaaattctcgcatttacaaccgttttttcactctggacacagac
cttcaagctcttcgctgggaaccttcaaagaaagacctcgagaaagccaagcttgatatt
tctgccataaaagagatcagactggggaaaaacacggaaacatttagaaacaatggcctt
gctgaccagatctgtgaggactgtgccttttccatactccacggggaaaactatgagtct
ctggacctagttgccaattcagcagatgtggcaaacatctgggtgtctgggttacggtac
ctggtttctcgaagtaagcagcctcttgattttatggagggcaaccagaacacaccacgg
ttcatgtggttgaaaacagtgtttgaagcagcagatgttgatgggaatgggattatgttg
gaagacacctctgtagagttaataaaacaactcaaccctactctgaaggaagccaagatc
aggttaaagtttaaagaaatccagaagagcaaggaaaaactaaccacccgcgtgaccgaa
gaggaattttgtgaagctttttgtgaactttgcaccaggccagaagtgtatttcttactt
gtacagatatctaaaaacaaagaatatttggatgccaatgatctcatgctctttttagaa
gctgagcaaggagtcacccatatcaccgaggatatatgcttagacatcataaggagatac
gaactttctgaagagggacgtcaaaaagggtttcttgcaattgatggctttacccagtat
ttattgtcatcagaatgtgacatttttgatcctgagcaaaagaaggttgcccaagatatg
acccagccattatctcactactatatcaatgcctctcataacacctatctaatagaagac
cagttcagggggccagctgacatcaatgggtacattagagctttgaaaatgggctgtcga
agcgttgaactcgatgtaagtgatggttcagataatgaaccaatcctttgtaatcgaaat
aacatgacaacccatgtttcctttcgaagtgtcatagaggtaataaataaatttgccttt
gttgcttctgaatacccactcattctttgcttgggaaatcactgctccttgccgcagcag
aaggtaatggctcaacagatgaaaaaggtctttggcaataaactctatactgaagcacct
ttgccctcagaatcctacctcccatcaccagaaaaattaaaaagaatgatcattgtgaaa
ggaaagaagttgccttctgatccagatgtgttagaaggagaagtaacagatgaagatgaa
gaagctgaaatgtctcgaaggatgtcggtagattacaatggtgagcagaagcaaatccga
ctctgtagggagctctctgatttggtgtctatttgtaaatctgttcaatacagggatttt
gaactatctatgaaaagccaaaactattgggaaatgtgttcatttagtgaaacagaggcc
agccgcattgcaaatgagtacccagaggattttgttaattataataagaagttcttatca
agaatctatccaagtgccatgaggatcgattccagtaacttgaatccacaggacttttgg
aattgtggctgtcagattgtagcaatgaattttcagactccgggtccaatgatggacctt
cacacgggctggtttcttcaaaacgggggatgtggttatgttctaaggccgtctataatg
cgagatgaagtttcttacttcagcgcaaatacaaagggcattctacctggggtgtctcct
ctagctcttcatatcaagatcatcagtggtcagaatttcccaaagcccaagggagcttgt
gccaaaggggatgtcatagatccctatgtttgtatagagatacacggaattccagcggat
tgttcggaacaaagaactaaaactgtacagcaaaacagtgataatcctatttttgatgaa
acttttgagttccaagtaaacctacctgagctggccatgatccgttttgttgttctggat
gatgactacattggggatgagtttatagggcaatatacgataccatttgaatgtttgcag
cctggatatcggcatgttcccctgcgttcttttgtgggtgacatcatggagcacgtaacc
ctttttgtccacatagcaataactaatcgaagtggaggaggaaaggcacagaagcgcagt
ctttcagtgagaatggggaagaaagttcgggaatataccatgctcaggaatatcggtctt
aaaaccattgatgacatctttaaaatagcggttcatccattacgagaagccatagatatg
agagaaaatatgcagaatgcaatcgtgtctattaaggaactatgtggactccctccaatt
gccagtctgaagcagtgcctgttaactctgtcatctcggctcatcaccagtgacaatact
ccttcagtctcacttgtgatgaaagacagctttccttacctggagcctctgggtgcaatt
ccagatgtgcagaaaaagatgctgactgcttatgatctgatgattcaagagagccggttt
ctcatagaaatggcggacacagtccaggaaaagattgtacagtgtcagaaagcagggatg
gagttccatgaagaacttcataatttgggggcaaaagaaggcttgaagggaagaaaactc
aacaaagcaactgagagctttgcttggaacattacagtattgaagggccaaggagatctg
ttgaagaatgccaagaatgaagctatagaaaacatgaagcagatccagctggcatgcctg
tcctgtggactgagtaaagcccccagcagcagtgctgaggccaagagcaagcgcagcctg
gaagccatagaggagaaggaaagtagtgaggagaatgggaagctgtga

DBGET integrated database retrieval system